Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2199640..2199898 | Replicon | chromosome |
Accession | NZ_CP058209 | ||
Organism | Escherichia marmotae strain RHB24-C12 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | - |
Locus tag | HVY12_RS10740 | Protein ID | WP_000935262.1 |
Coordinates | 2199689..2199898 (+) | Length | 70 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 2199640..2199697 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HVY12_RS10715 | 2195395..2196336 | - | 942 | WP_000767344.1 | bifunctional riboflavin kinase/FAD synthetase | - |
HVY12_RS10720 | 2196344..2196562 | - | 219 | Protein_2100 | DUF2575 domain-containing protein | - |
HVY12_RS10725 | 2196665..2196928 | + | 264 | WP_001274018.1 | 30S ribosomal protein S20 | - |
HVY12_RS10730 | 2197031..2197936 | - | 906 | WP_000062876.1 | transcriptional activator NhaR | - |
HVY12_RS10735 | 2197996..2199162 | - | 1167 | WP_000681378.1 | Na+/H+ antiporter NhaA | - |
- | 2199640..2199697 | - | 58 | - | - | Antitoxin |
HVY12_RS10740 | 2199689..2199898 | + | 210 | WP_000935262.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
HVY12_RS10745 | 2200003..2201133 | - | 1131 | WP_001118463.1 | molecular chaperone DnaJ | - |
HVY12_RS10750 | 2201222..2203138 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
HVY12_RS10755 | 2203515..2203767 | + | 253 | Protein_2107 | DUF2541 family protein | - |
HVY12_RS10760 | 2204007..2204573 | + | 567 | WP_000528538.1 | acetate uptake transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 70 a.a. Molecular weight: 7742.28 Da Isoelectric Point: 9.3680
>T166139 WP_000935262.1 NZ_CP058209:2199689-2199898 [Escherichia marmotae]
MLNTCRVPLTDRKVKEKRAMKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MLNTCRVPLTDRKVKEKRAMKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 210 bp
>T166139 NZ_CP074047:179260-179367 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT166139 NZ_CP058209:c2199697-2199640 [Escherichia marmotae]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|