Detailed information of TA system TA165807

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokX/Ldr(toxin)
• Location: 4273420..4273639
• Replicon: chromosome
• Accession: NZ_CP058057
• Organism: Escherichia fergusonii strain RHB02-C22

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: -
• Locus tag: HVV54_RS20530
• Protein ID: WP_181202942.1
• Coordinates: 4273420..4273527 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokX
Locus tag	-
Coordinates	4273576..4273639 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HVV54_RS20500	4268470..4268658	-	189	WP_001063310.1	YhjR family protein	-
HVV54_RS20505	4268945..4270504	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HVV54_RS20510	4270501..4270692	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
HVV54_RS20515	4270689..4272368	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HVV54_RS20520	4272455..4272562	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4272620..4272674	+	55	NuclAT_23	-	-
-	4272620..4272674	+	55	NuclAT_23	-	-
-	4272620..4272674	+	55	NuclAT_23	-	-
-	4272620..4272674	+	55	NuclAT_23	-	-
-	4272620..4272674	+	55	NuclAT_26	-	-
-	4272620..4272674	+	55	NuclAT_26	-	-
-	4272620..4272674	+	55	NuclAT_26	-	-
-	4272620..4272674	+	55	NuclAT_26	-	-
-	4272620..4272674	+	55	NuclAT_29	-	-
-	4272620..4272674	+	55	NuclAT_29	-	-
-	4272620..4272674	+	55	NuclAT_29	-	-
-	4272620..4272674	+	55	NuclAT_29	-	-
-	4272620..4272674	+	55	NuclAT_32	-	-
-	4272620..4272674	+	55	NuclAT_32	-	-
-	4272620..4272674	+	55	NuclAT_32	-	-
-	4272620..4272674	+	55	NuclAT_32	-	-
-	4272620..4272676	+	57	NuclAT_17	-	-
-	4272620..4272676	+	57	NuclAT_17	-	-
-	4272620..4272676	+	57	NuclAT_17	-	-
-	4272620..4272676	+	57	NuclAT_17	-	-
-	4272620..4272676	+	57	NuclAT_20	-	-
-	4272620..4272676	+	57	NuclAT_20	-	-
-	4272620..4272676	+	57	NuclAT_20	-	-
-	4272620..4272676	+	57	NuclAT_20	-	-
HVV54_RS20525	4272938..4273045	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4273094..4273157	+	64	NuclAT_22	-	-
-	4273094..4273157	+	64	NuclAT_22	-	-
-	4273094..4273157	+	64	NuclAT_22	-	-
-	4273094..4273157	+	64	NuclAT_22	-	-
-	4273094..4273157	+	64	NuclAT_25	-	-
-	4273094..4273157	+	64	NuclAT_25	-	-
-	4273094..4273157	+	64	NuclAT_25	-	-
-	4273094..4273157	+	64	NuclAT_25	-	-
-	4273094..4273157	+	64	NuclAT_28	-	-
-	4273094..4273157	+	64	NuclAT_28	-	-
-	4273094..4273157	+	64	NuclAT_28	-	-
-	4273094..4273157	+	64	NuclAT_28	-	-
-	4273094..4273157	+	64	NuclAT_31	-	-
-	4273094..4273157	+	64	NuclAT_31	-	-
-	4273094..4273157	+	64	NuclAT_31	-	-
-	4273094..4273157	+	64	NuclAT_31	-	-
-	4273094..4273159	+	66	NuclAT_16	-	-
-	4273094..4273159	+	66	NuclAT_16	-	-
-	4273094..4273159	+	66	NuclAT_16	-	-
-	4273094..4273159	+	66	NuclAT_16	-	-
-	4273094..4273159	+	66	NuclAT_19	-	-
-	4273094..4273159	+	66	NuclAT_19	-	-
-	4273094..4273159	+	66	NuclAT_19	-	-
-	4273094..4273159	+	66	NuclAT_19	-	-
HVV54_RS20530	4273420..4273527	-	108	WP_181202942.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4273576..4273639	+	64	NuclAT_21	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_21	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_21	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_21	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_24	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_24	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_24	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_24	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_27	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_27	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_27	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_27	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_30	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_30	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_30	-	Antitoxin
-	4273576..4273639	+	64	NuclAT_30	-	Antitoxin
-	4273576..4273641	+	66	NuclAT_15	-	-
-	4273576..4273641	+	66	NuclAT_15	-	-
-	4273576..4273641	+	66	NuclAT_15	-	-
-	4273576..4273641	+	66	NuclAT_15	-	-
-	4273576..4273641	+	66	NuclAT_18	-	-
-	4273576..4273641	+	66	NuclAT_18	-	-
-	4273576..4273641	+	66	NuclAT_18	-	-
-	4273576..4273641	+	66	NuclAT_18	-	-
HVV54_RS20535	4273964..4275160	+	1197	WP_181202943.1	methionine gamma-lyase	-
HVV54_RS20540	4275409..4276706	+	1298	Protein_4009	transporter	-
HVV54_RS20545	4276722..4277933	-	1212	WP_181202945.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-34)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3850.60 Da
• Isoelectric Point: 7.0027

>T165807 WP_181202942.1 NZ_CP058057:c4273527-4273420 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRN

Nucleotide

• Length: 108 bp

>T165807 NZ_CP073974:3798539-3798946 [Escherichia coli]
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCACAGTGGCTTTCCTTGCTGATTCATGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCACTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGCG
TTCGCAGCCAGCGGCGTATTAATGCTCGCCAGGGGGAAATTCGCTTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGAGCATCGTCAAAGCACCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGATGGCGGTAAACGGCA
ACATTTATGGCTGGCAGCCGACAGCATGGACGAAGCTGAATGGCGGGATTTACGGCGGATTTTGTTGCAACAAGAGACGC
AAAGATAA

Antitoxin

Nucleotide

• Length: 64 bp

>AT165807 NZ_CP058057:4273576-4273639 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGAATACCTGCAACGTGCGGGGGTTTT

Structures

Antitoxin