Detailed information of TA system TA165778

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-ohsC/Ldr(toxin)
• Location: 4163097..4163316
• Replicon: chromosome
• Accession: NZ_CP057918
• Organism: Escherichia fergusonii strain RHB10-C04

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: S1NWX0
• Locus tag: HVW38_RS19960
• Protein ID: WP_001295224.1
• Coordinates: 4163097..4163204 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	ohsC
Locus tag	-
Coordinates	4163253..4163316 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HVW38_RS19930	4158145..4158333	-	189	WP_001063310.1	YhjR family protein	-
HVW38_RS19935	4158620..4160179	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HVW38_RS19940	4160176..4160367	+	192	WP_046077700.1	cellulose biosynthesis protein BcsF	-
HVW38_RS19945	4160364..4162043	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HVW38_RS19950	4162130..4162237	-	108	WP_114091462.1	type I toxin-antitoxin system toxin Ldr family protein	-
HVW38_RS19955	4162613..4162720	-	108	WP_002431793.1	type I toxin-antitoxin system toxin Ldr family protein	-
HVW38_RS19960	4163097..4163204	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4163253..4163316	+	64	NuclAT_15	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_15	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_15	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_15	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_16	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_16	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_16	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_16	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_17	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_17	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_17	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_17	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_18	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_18	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_18	-	Antitoxin
-	4163253..4163316	+	64	NuclAT_18	-	Antitoxin
-	4163253..4163318	+	66	NuclAT_13	-	-
-	4163253..4163318	+	66	NuclAT_13	-	-
-	4163253..4163318	+	66	NuclAT_13	-	-
-	4163253..4163318	+	66	NuclAT_13	-	-
-	4163253..4163318	+	66	NuclAT_14	-	-
-	4163253..4163318	+	66	NuclAT_14	-	-
-	4163253..4163318	+	66	NuclAT_14	-	-
-	4163253..4163318	+	66	NuclAT_14	-	-
HVW38_RS19965	4163641..4164837	+	1197	WP_181465070.1	methionine gamma-lyase	-
HVW38_RS19970	4165087..4166385	+	1299	WP_001152711.1	amino acid permease	-
HVW38_RS19975	4166401..4167612	-	1212	WP_125282763.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3882.70 Da
• Isoelectric Point: 9.0157

>T165778 WP_001295224.1 NZ_CP057918:c4163204-4163097 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Nucleotide

• Length: 108 bp

>T165778 NZ_CP073962:c2466935-2466759 [Escherichia coli]
GTGAAACAAAGCGAGTTCAGACGTTGGCTCGAATCTCAGGGCGTCGATGTAGCGAATAGCAGCAACCATTTGAAACTCAG
GTTTCATGGGAGGCGCAGTGTCATGCCGCGTCACCCCTGCGATGAGATTAAAGAACCATTGCGTAAAGCAATCCTGAAAC
AACTCGGTTTGAGTTAA

Antitoxin

Nucleotide

• Length: 64 bp

>AT165778 NZ_CP057918:4163253-4163316 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Toxin

• AlphaFold DB: A0A4P7TSJ7

Antitoxin