Detailed information of TA system TA165755

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-ohsC/Ldr(toxin)
• Location: 4162911..4163130
• Replicon: chromosome
• Accession: NZ_CP057896
• Organism: Escherichia fergusonii strain RHB10-C23

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: S1NWX0
• Locus tag: HVW49_RS19950
• Protein ID: WP_001295224.1
• Coordinates: 4162911..4163018 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	ohsC
Locus tag	-
Coordinates	4163067..4163130 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HVW49_RS19920	4157959..4158147	-	189	WP_001063310.1	YhjR family protein	-
HVW49_RS19925	4158434..4159993	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HVW49_RS19930	4159990..4160181	+	192	WP_046077700.1	cellulose biosynthesis protein BcsF	-
HVW49_RS19935	4160178..4161857	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HVW49_RS19940	4161944..4162051	-	108	WP_114091462.1	type I toxin-antitoxin system toxin Ldr family protein	-
HVW49_RS19945	4162427..4162534	-	108	WP_002431793.1	type I toxin-antitoxin system toxin Ldr family protein	-
HVW49_RS19950	4162911..4163018	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4163067..4163130	+	64	NuclAT_15	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_15	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_15	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_15	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_16	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_16	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_16	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_16	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_17	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_17	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_17	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_17	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_18	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_18	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_18	-	Antitoxin
-	4163067..4163130	+	64	NuclAT_18	-	Antitoxin
-	4163067..4163132	+	66	NuclAT_13	-	-
-	4163067..4163132	+	66	NuclAT_13	-	-
-	4163067..4163132	+	66	NuclAT_13	-	-
-	4163067..4163132	+	66	NuclAT_13	-	-
-	4163067..4163132	+	66	NuclAT_14	-	-
-	4163067..4163132	+	66	NuclAT_14	-	-
-	4163067..4163132	+	66	NuclAT_14	-	-
-	4163067..4163132	+	66	NuclAT_14	-	-
HVW49_RS19955	4163455..4164651	+	1197	WP_181465070.1	methionine gamma-lyase	-
HVW49_RS19960	4164901..4166199	+	1299	WP_001152711.1	amino acid permease	-
HVW49_RS19965	4166215..4167426	-	1212	WP_125282763.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3882.70 Da
• Isoelectric Point: 9.0157

>T165755 WP_001295224.1 NZ_CP057896:c4163018-4162911 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Nucleotide

• Length: 108 bp

>T165755 NZ_CP073958:c2508410-2508234 [Escherichia coli]
GTGAAACAAAGCGAGTTCAGACGTTGGCTCGAATCTCAGGGCGTCGATGTAGCGAATGGCAGCAACCATTTGAAACTCAG
GTTTCATGGGAGGCGCAGTGTCATGCCGCGTCACCCCTGCGATGAGATTAAAGAACCATTGCGTAAAGCAATCCTGAAAC
AACTCGGTTTGAGTTAA

Antitoxin

Nucleotide

• Length: 64 bp

>AT165755 NZ_CP057896:4163067-4163130 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Toxin

• AlphaFold DB: A0A4P7TSJ7

Antitoxin