Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-sokA/Ldr(toxin)
Location 2583660..2583879 Replicon chromosome
Accession NZ_CP057692
Organism Escherichia fergusonii strain RHB17-C11

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag HVX29_RS12525 Protein ID WP_000170738.1
Coordinates 2583660..2583767 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokA
Locus tag -
Coordinates 2583816..2583879 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HVX29_RS12495 2578709..2578897 - 189 WP_001063310.1 YhjR family protein -
HVX29_RS12500 2579184..2580743 + 1560 WP_001070267.1 cellulose biosynthesis protein BcsE -
HVX29_RS12505 2580740..2580931 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
HVX29_RS12510 2580928..2582607 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
HVX29_RS12515 2582694..2582801 - 108 WP_000170746.1 type I toxin-antitoxin system toxin Ldr family protein -
HVX29_RS12520 2583177..2583284 - 108 WP_002431793.1 type I toxin-antitoxin system toxin Ldr family protein -
HVX29_RS12525 2583660..2583767 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2583816..2583879 + 64 NuclAT_17 - Antitoxin
- 2583816..2583879 + 64 NuclAT_17 - Antitoxin
- 2583816..2583879 + 64 NuclAT_17 - Antitoxin
- 2583816..2583879 + 64 NuclAT_17 - Antitoxin
- 2583816..2583879 + 64 NuclAT_19 - Antitoxin
- 2583816..2583879 + 64 NuclAT_19 - Antitoxin
- 2583816..2583879 + 64 NuclAT_19 - Antitoxin
- 2583816..2583879 + 64 NuclAT_19 - Antitoxin
- 2583816..2583879 + 64 NuclAT_21 - Antitoxin
- 2583816..2583879 + 64 NuclAT_21 - Antitoxin
- 2583816..2583879 + 64 NuclAT_21 - Antitoxin
- 2583816..2583879 + 64 NuclAT_21 - Antitoxin
- 2583816..2583879 + 64 NuclAT_23 - Antitoxin
- 2583816..2583879 + 64 NuclAT_23 - Antitoxin
- 2583816..2583879 + 64 NuclAT_23 - Antitoxin
- 2583816..2583879 + 64 NuclAT_23 - Antitoxin
- 2583816..2583881 + 66 NuclAT_12 - -
- 2583816..2583881 + 66 NuclAT_12 - -
- 2583816..2583881 + 66 NuclAT_12 - -
- 2583816..2583881 + 66 NuclAT_12 - -
- 2583816..2583881 + 66 NuclAT_14 - -
- 2583816..2583881 + 66 NuclAT_14 - -
- 2583816..2583881 + 66 NuclAT_14 - -
- 2583816..2583881 + 66 NuclAT_14 - -
HVX29_RS12530 2584132..2584239 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2584288..2584351 + 64 NuclAT_16 - -
- 2584288..2584351 + 64 NuclAT_16 - -
- 2584288..2584351 + 64 NuclAT_16 - -
- 2584288..2584351 + 64 NuclAT_16 - -
- 2584288..2584351 + 64 NuclAT_18 - -
- 2584288..2584351 + 64 NuclAT_18 - -
- 2584288..2584351 + 64 NuclAT_18 - -
- 2584288..2584351 + 64 NuclAT_18 - -
- 2584288..2584351 + 64 NuclAT_20 - -
- 2584288..2584351 + 64 NuclAT_20 - -
- 2584288..2584351 + 64 NuclAT_20 - -
- 2584288..2584351 + 64 NuclAT_20 - -
- 2584288..2584351 + 64 NuclAT_22 - -
- 2584288..2584351 + 64 NuclAT_22 - -
- 2584288..2584351 + 64 NuclAT_22 - -
- 2584288..2584351 + 64 NuclAT_22 - -
- 2584288..2584353 + 66 NuclAT_11 - -
- 2584288..2584353 + 66 NuclAT_11 - -
- 2584288..2584353 + 66 NuclAT_11 - -
- 2584288..2584353 + 66 NuclAT_11 - -
- 2584288..2584353 + 66 NuclAT_13 - -
- 2584288..2584353 + 66 NuclAT_13 - -
- 2584288..2584353 + 66 NuclAT_13 - -
- 2584288..2584353 + 66 NuclAT_13 - -
HVX29_RS12535 2584676..2585872 + 1197 WP_001016304.1 methionine gamma-lyase -
HVX29_RS12540 2586122..2587420 + 1299 WP_001152712.1 amino acid permease -
HVX29_RS12545 2587436..2588647 - 1212 WP_181812673.1 sigma 54-interacting transcriptional regulator -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T165688 WP_000170738.1 NZ_CP057692:c2583767-2583660 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp

>T165688 NZ_CP073946:3563156-3563374 [Escherichia coli]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA

Antitoxin


Download         Length: 64 bp

>AT165688 NZ_CP057692:2583816-2583879 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A829L523


Antitoxin

Download structure file

References