Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-symR/Ldr(toxin)
Location 2613632..2613851 Replicon chromosome
Accession NZ_CP057657
Organism Escherichia fergusonii strain RHB19-C05

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag HVX45_RS12815 Protein ID WP_001295224.1
Coordinates 2613632..2613739 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name symR
Locus tag -
Coordinates 2613788..2613851 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HVX45_RS12785 2608674..2610233 + 1560 WP_001070267.1 cellulose biosynthesis protein BcsE -
HVX45_RS12790 2610230..2610421 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
HVX45_RS12795 2610418..2612097 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
HVX45_RS12800 2612184..2612291 - 108 WP_149012441.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2612349..2612403 + 55 NuclAT_22 - -
- 2612349..2612403 + 55 NuclAT_22 - -
- 2612349..2612403 + 55 NuclAT_22 - -
- 2612349..2612403 + 55 NuclAT_22 - -
- 2612349..2612403 + 55 NuclAT_25 - -
- 2612349..2612403 + 55 NuclAT_25 - -
- 2612349..2612403 + 55 NuclAT_25 - -
- 2612349..2612403 + 55 NuclAT_25 - -
- 2612349..2612403 + 55 NuclAT_28 - -
- 2612349..2612403 + 55 NuclAT_28 - -
- 2612349..2612403 + 55 NuclAT_28 - -
- 2612349..2612403 + 55 NuclAT_28 - -
- 2612349..2612403 + 55 NuclAT_31 - -
- 2612349..2612403 + 55 NuclAT_31 - -
- 2612349..2612403 + 55 NuclAT_31 - -
- 2612349..2612403 + 55 NuclAT_31 - -
- 2612349..2612405 + 57 NuclAT_15 - -
- 2612349..2612405 + 57 NuclAT_15 - -
- 2612349..2612405 + 57 NuclAT_15 - -
- 2612349..2612405 + 57 NuclAT_15 - -
- 2612349..2612405 + 57 NuclAT_18 - -
- 2612349..2612405 + 57 NuclAT_18 - -
- 2612349..2612405 + 57 NuclAT_18 - -
- 2612349..2612405 + 57 NuclAT_18 - -
HVX45_RS12805 2612667..2612774 - 108 WP_002431793.1 type I toxin-antitoxin system toxin Ldr family protein -
HVX45_RS12810 2613149..2613256 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2613305..2613368 + 64 NuclAT_21 - -
- 2613305..2613368 + 64 NuclAT_21 - -
- 2613305..2613368 + 64 NuclAT_21 - -
- 2613305..2613368 + 64 NuclAT_21 - -
- 2613305..2613368 + 64 NuclAT_24 - -
- 2613305..2613368 + 64 NuclAT_24 - -
- 2613305..2613368 + 64 NuclAT_24 - -
- 2613305..2613368 + 64 NuclAT_24 - -
- 2613305..2613368 + 64 NuclAT_27 - -
- 2613305..2613368 + 64 NuclAT_27 - -
- 2613305..2613368 + 64 NuclAT_27 - -
- 2613305..2613368 + 64 NuclAT_27 - -
- 2613305..2613368 + 64 NuclAT_30 - -
- 2613305..2613368 + 64 NuclAT_30 - -
- 2613305..2613368 + 64 NuclAT_30 - -
- 2613305..2613368 + 64 NuclAT_30 - -
- 2613305..2613370 + 66 NuclAT_14 - -
- 2613305..2613370 + 66 NuclAT_14 - -
- 2613305..2613370 + 66 NuclAT_14 - -
- 2613305..2613370 + 66 NuclAT_14 - -
- 2613305..2613370 + 66 NuclAT_17 - -
- 2613305..2613370 + 66 NuclAT_17 - -
- 2613305..2613370 + 66 NuclAT_17 - -
- 2613305..2613370 + 66 NuclAT_17 - -
HVX45_RS12815 2613632..2613739 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2613788..2613851 + 64 NuclAT_20 - Antitoxin
- 2613788..2613851 + 64 NuclAT_20 - Antitoxin
- 2613788..2613851 + 64 NuclAT_20 - Antitoxin
- 2613788..2613851 + 64 NuclAT_20 - Antitoxin
- 2613788..2613851 + 64 NuclAT_23 - Antitoxin
- 2613788..2613851 + 64 NuclAT_23 - Antitoxin
- 2613788..2613851 + 64 NuclAT_23 - Antitoxin
- 2613788..2613851 + 64 NuclAT_23 - Antitoxin
- 2613788..2613851 + 64 NuclAT_26 - Antitoxin
- 2613788..2613851 + 64 NuclAT_26 - Antitoxin
- 2613788..2613851 + 64 NuclAT_26 - Antitoxin
- 2613788..2613851 + 64 NuclAT_26 - Antitoxin
- 2613788..2613851 + 64 NuclAT_29 - Antitoxin
- 2613788..2613851 + 64 NuclAT_29 - Antitoxin
- 2613788..2613851 + 64 NuclAT_29 - Antitoxin
- 2613788..2613851 + 64 NuclAT_29 - Antitoxin
- 2613788..2613853 + 66 NuclAT_13 - -
- 2613788..2613853 + 66 NuclAT_13 - -
- 2613788..2613853 + 66 NuclAT_13 - -
- 2613788..2613853 + 66 NuclAT_13 - -
- 2613788..2613853 + 66 NuclAT_16 - -
- 2613788..2613853 + 66 NuclAT_16 - -
- 2613788..2613853 + 66 NuclAT_16 - -
- 2613788..2613853 + 66 NuclAT_16 - -
HVX45_RS12820 2614175..2615371 + 1197 WP_046082930.1 methionine gamma-lyase -
HVX45_RS12825 2615621..2616919 + 1299 WP_046081028.1 amino acid permease -
HVX45_RS12830 2616935..2618146 - 1212 WP_169710647.1 sigma 54-interacting transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T165629 WP_001295224.1 NZ_CP057657:c2613739-2613632 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T165629 NZ_CP073936:3451024-3451242 [Escherichia coli]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA

Antitoxin


Download         Length: 64 bp

>AT165629 NZ_CP057657:2613788-2613851 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7

Antitoxin

Download structure file

References