Detailed information of TA system TA165627

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokA/Ldr(toxin)
• Location: 2613149..2613368
• Replicon: chromosome
• Accession: NZ_CP057657
• Organism: Escherichia fergusonii strain RHB19-C05

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A829L523
• Locus tag: HVX45_RS12810
• Protein ID: WP_000170738.1
• Coordinates: 2613149..2613256 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokA
Locus tag	-
Coordinates	2613305..2613368 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HVX45_RS12780	2608199..2608387	-	189	WP_001063310.1	YhjR family protein	-
HVX45_RS12785	2608674..2610233	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HVX45_RS12790	2610230..2610421	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
HVX45_RS12795	2610418..2612097	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HVX45_RS12800	2612184..2612291	-	108	WP_149012441.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2612349..2612403	+	55	NuclAT_22	-	-
-	2612349..2612403	+	55	NuclAT_22	-	-
-	2612349..2612403	+	55	NuclAT_22	-	-
-	2612349..2612403	+	55	NuclAT_22	-	-
-	2612349..2612403	+	55	NuclAT_25	-	-
-	2612349..2612403	+	55	NuclAT_25	-	-
-	2612349..2612403	+	55	NuclAT_25	-	-
-	2612349..2612403	+	55	NuclAT_25	-	-
-	2612349..2612403	+	55	NuclAT_28	-	-
-	2612349..2612403	+	55	NuclAT_28	-	-
-	2612349..2612403	+	55	NuclAT_28	-	-
-	2612349..2612403	+	55	NuclAT_28	-	-
-	2612349..2612403	+	55	NuclAT_31	-	-
-	2612349..2612403	+	55	NuclAT_31	-	-
-	2612349..2612403	+	55	NuclAT_31	-	-
-	2612349..2612403	+	55	NuclAT_31	-	-
-	2612349..2612405	+	57	NuclAT_15	-	-
-	2612349..2612405	+	57	NuclAT_15	-	-
-	2612349..2612405	+	57	NuclAT_15	-	-
-	2612349..2612405	+	57	NuclAT_15	-	-
-	2612349..2612405	+	57	NuclAT_18	-	-
-	2612349..2612405	+	57	NuclAT_18	-	-
-	2612349..2612405	+	57	NuclAT_18	-	-
-	2612349..2612405	+	57	NuclAT_18	-	-
HVX45_RS12805	2612667..2612774	-	108	WP_002431793.1	type I toxin-antitoxin system toxin Ldr family protein	-
HVX45_RS12810	2613149..2613256	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2613305..2613368	+	64	NuclAT_21	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_21	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_21	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_21	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_24	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_24	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_24	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_24	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_27	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_27	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_27	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_27	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_30	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_30	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_30	-	Antitoxin
-	2613305..2613368	+	64	NuclAT_30	-	Antitoxin
-	2613305..2613370	+	66	NuclAT_14	-	-
-	2613305..2613370	+	66	NuclAT_14	-	-
-	2613305..2613370	+	66	NuclAT_14	-	-
-	2613305..2613370	+	66	NuclAT_14	-	-
-	2613305..2613370	+	66	NuclAT_17	-	-
-	2613305..2613370	+	66	NuclAT_17	-	-
-	2613305..2613370	+	66	NuclAT_17	-	-
-	2613305..2613370	+	66	NuclAT_17	-	-
HVX45_RS12815	2613632..2613739	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2613788..2613851	+	64	NuclAT_20	-	-
-	2613788..2613851	+	64	NuclAT_20	-	-
-	2613788..2613851	+	64	NuclAT_20	-	-
-	2613788..2613851	+	64	NuclAT_20	-	-
-	2613788..2613851	+	64	NuclAT_23	-	-
-	2613788..2613851	+	64	NuclAT_23	-	-
-	2613788..2613851	+	64	NuclAT_23	-	-
-	2613788..2613851	+	64	NuclAT_23	-	-
-	2613788..2613851	+	64	NuclAT_26	-	-
-	2613788..2613851	+	64	NuclAT_26	-	-
-	2613788..2613851	+	64	NuclAT_26	-	-
-	2613788..2613851	+	64	NuclAT_26	-	-
-	2613788..2613851	+	64	NuclAT_29	-	-
-	2613788..2613851	+	64	NuclAT_29	-	-
-	2613788..2613851	+	64	NuclAT_29	-	-
-	2613788..2613851	+	64	NuclAT_29	-	-
-	2613788..2613853	+	66	NuclAT_13	-	-
-	2613788..2613853	+	66	NuclAT_13	-	-
-	2613788..2613853	+	66	NuclAT_13	-	-
-	2613788..2613853	+	66	NuclAT_13	-	-
-	2613788..2613853	+	66	NuclAT_16	-	-
-	2613788..2613853	+	66	NuclAT_16	-	-
-	2613788..2613853	+	66	NuclAT_16	-	-
-	2613788..2613853	+	66	NuclAT_16	-	-
HVX45_RS12820	2614175..2615371	+	1197	WP_046082930.1	methionine gamma-lyase	-
HVX45_RS12825	2615621..2616919	+	1299	WP_046081028.1	amino acid permease	-
HVX45_RS12830	2616935..2618146	-	1212	WP_169710647.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3864.67 Da
• Isoelectric Point: 9.0157

>T165627 WP_000170738.1 NZ_CP057657:c2613256-2613149 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Nucleotide

• Length: 108 bp

>T165627 NZ_CP073936:2696144-2696251 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 64 bp

>AT165627 NZ_CP057657:2613305-2613368 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Toxin

• AlphaFold DB: A0A829L523

Antitoxin