Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4300221..4300479 | Replicon | chromosome |
| Accession | NZ_CP057565 | ||
| Organism | Escherichia fergusonii strain RHB23-C01 | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | - |
| Locus tag | HVX91_RS20560 | Protein ID | WP_181202950.1 |
| Coordinates | 4300221..4300373 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 4300424..4300479 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HVX91_RS20535 | 4296086..4296796 | - | 711 | WP_000190514.1 | DUF3053 domain-containing protein | - |
| HVX91_RS20540 | 4297234..4298604 | + | 1371 | WP_181812031.1 | MFS transporter | - |
| HVX91_RS20545 | 4298854..4299144 | + | 291 | WP_000455800.1 | HTH-type transcriptional regulator | - |
| HVX91_RS20550 | 4299426..4299638 | + | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| HVX91_RS20555 | 4299692..4300063 | - | 372 | WP_072274202.1 | membrane protein insertion efficiency factor YidD | - |
| HVX91_RS20560 | 4300221..4300373 | - | 153 | WP_181202950.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| - | 4300424..4300479 | + | 56 | - | - | Antitoxin |
| HVX91_RS20565 | 4300674..4301033 | - | 360 | WP_141095883.1 | hypothetical protein | - |
| HVX91_RS20570 | 4301102..4303171 | - | 2070 | WP_181812032.1 | glycine--tRNA ligase subunit beta | - |
| HVX91_RS20575 | 4303181..4304092 | - | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| HVX91_RS20580 | 4304188..4304487 | - | 300 | WP_024256552.1 | YsaB family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5926.17 Da Isoelectric Point: 6.9160
>T165539 WP_181202950.1 NZ_CP057565:c4300373-4300221 [Escherichia fergusonii]
MPQKYGLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
MPQKYGLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
Download Length: 153 bp
>T165539 NZ_CP073924:2741402-2741509 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 56 bp
>AT165539 NZ_CP057565:4300424-4300479 [Escherichia fergusonii]
GTTGAAGCATAGAGGCAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTGAAGCATAGAGGCAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|