Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
Location | 2611519..2611738 | Replicon | chromosome |
Accession | NZ_CP057463 | ||
Organism | Escherichia fergusonii strain RHB26-C03 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A826RQE3 |
Locus tag | HVY27_RS12905 | Protein ID | WP_000170746.1 |
Coordinates | 2611519..2611626 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | ohsC | ||
Locus tag | - | ||
Coordinates | 2611675..2611738 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HVY27_RS12880 | 2606755..2607522 | - | 768 | WP_181198551.1 | cellulose biosynthesis protein BcsQ | - |
HVY27_RS12885 | 2607534..2607722 | - | 189 | WP_001063310.1 | YhjR family protein | - |
HVY27_RS12890 | 2608009..2609568 | + | 1560 | WP_001070267.1 | cellulose biosynthesis protein BcsE | - |
HVY27_RS12895 | 2609565..2609756 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
HVY27_RS12900 | 2609753..2611432 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
HVY27_RS12905 | 2611519..2611626 | - | 108 | WP_000170746.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 2611675..2611738 | + | 64 | NuclAT_13 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_13 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_13 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_13 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_14 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_14 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_14 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_14 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_15 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_15 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_15 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_15 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_16 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_16 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_16 | - | Antitoxin |
- | 2611675..2611738 | + | 64 | NuclAT_16 | - | Antitoxin |
- | 2611675..2611740 | + | 66 | NuclAT_10 | - | - |
- | 2611675..2611740 | + | 66 | NuclAT_10 | - | - |
- | 2611675..2611740 | + | 66 | NuclAT_10 | - | - |
- | 2611675..2611740 | + | 66 | NuclAT_10 | - | - |
- | 2611675..2611740 | + | 66 | NuclAT_11 | - | - |
- | 2611675..2611740 | + | 66 | NuclAT_11 | - | - |
- | 2611675..2611740 | + | 66 | NuclAT_11 | - | - |
- | 2611675..2611740 | + | 66 | NuclAT_11 | - | - |
HVY27_RS12910 | 2612062..2613258 | + | 1197 | WP_104920204.1 | methionine gamma-lyase | - |
HVY27_RS12915 | 2613508..2614806 | + | 1299 | WP_181198552.1 | amino acid permease | - |
HVY27_RS12920 | 2614822..2616033 | - | 1212 | WP_181198553.1 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3912.73 Da Isoelectric Point: 9.0157
>T165344 WP_000170746.1 NZ_CP057463:c2611626-2611519 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVITGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVITGILASMIVNWLNKRK
Download Length: 108 bp
>T165344 NZ_CP073824:679628-679837 [Staphylococcus epidermidis]
ATGAAATTGAAAAAAGGATTGATAAATGTTTCAGGTATTAAAACAACTGAACAAGCTAAACAGCTCAAAGATCATTTATC
TAAGATGATAGGCATCAATAGTGTGGATATCGATTACCAAATGAATGAGATTCGAGTAGAATTTGACACTCCTGCAAATT
TAAATAACATTGAAAAAGAAATTTACGATTACGGATTTCGTATTTTGTAA
ATGAAATTGAAAAAAGGATTGATAAATGTTTCAGGTATTAAAACAACTGAACAAGCTAAACAGCTCAAAGATCATTTATC
TAAGATGATAGGCATCAATAGTGTGGATATCGATTACCAAATGAATGAGATTCGAGTAGAATTTGACACTCCTGCAAATT
TAAATAACATTGAAAAAGAAATTTACGATTACGGATTTCGTATTTTGTAA
Antitoxin
Download Length: 64 bp
>AT165344 NZ_CP057463:2611675-2611738 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|