Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 4119688..4119907 Replicon chromosome
Accession NZ_CP057458
Organism Escherichia fergusonii strain RHB26-C09

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag HVY30_RS19875 Protein ID WP_000170738.1
Coordinates 4119688..4119795 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 4119844..4119907 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HVY30_RS19845 4114738..4114926 - 189 WP_001063310.1 YhjR family protein -
HVY30_RS19850 4115213..4116772 + 1560 WP_001070267.1 cellulose biosynthesis protein BcsE -
HVY30_RS19855 4116769..4116960 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
HVY30_RS19860 4116957..4118636 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
HVY30_RS19865 4118723..4118830 - 108 WP_114091462.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4118888..4118942 + 55 NuclAT_20 - -
- 4118888..4118942 + 55 NuclAT_20 - -
- 4118888..4118942 + 55 NuclAT_20 - -
- 4118888..4118942 + 55 NuclAT_20 - -
- 4118888..4118942 + 55 NuclAT_23 - -
- 4118888..4118942 + 55 NuclAT_23 - -
- 4118888..4118942 + 55 NuclAT_23 - -
- 4118888..4118942 + 55 NuclAT_23 - -
- 4118888..4118942 + 55 NuclAT_26 - -
- 4118888..4118942 + 55 NuclAT_26 - -
- 4118888..4118942 + 55 NuclAT_26 - -
- 4118888..4118942 + 55 NuclAT_26 - -
- 4118888..4118942 + 55 NuclAT_29 - -
- 4118888..4118942 + 55 NuclAT_29 - -
- 4118888..4118942 + 55 NuclAT_29 - -
- 4118888..4118942 + 55 NuclAT_29 - -
- 4118888..4118944 + 57 NuclAT_14 - -
- 4118888..4118944 + 57 NuclAT_14 - -
- 4118888..4118944 + 57 NuclAT_14 - -
- 4118888..4118944 + 57 NuclAT_14 - -
- 4118888..4118944 + 57 NuclAT_17 - -
- 4118888..4118944 + 57 NuclAT_17 - -
- 4118888..4118944 + 57 NuclAT_17 - -
- 4118888..4118944 + 57 NuclAT_17 - -
HVY30_RS19870 4119206..4119313 - 108 WP_072132476.1 type I toxin-antitoxin system toxin Ldr family protein -
HVY30_RS19875 4119688..4119795 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4119844..4119907 + 64 NuclAT_19 - Antitoxin
- 4119844..4119907 + 64 NuclAT_19 - Antitoxin
- 4119844..4119907 + 64 NuclAT_19 - Antitoxin
- 4119844..4119907 + 64 NuclAT_19 - Antitoxin
- 4119844..4119907 + 64 NuclAT_22 - Antitoxin
- 4119844..4119907 + 64 NuclAT_22 - Antitoxin
- 4119844..4119907 + 64 NuclAT_22 - Antitoxin
- 4119844..4119907 + 64 NuclAT_22 - Antitoxin
- 4119844..4119907 + 64 NuclAT_25 - Antitoxin
- 4119844..4119907 + 64 NuclAT_25 - Antitoxin
- 4119844..4119907 + 64 NuclAT_25 - Antitoxin
- 4119844..4119907 + 64 NuclAT_25 - Antitoxin
- 4119844..4119907 + 64 NuclAT_28 - Antitoxin
- 4119844..4119907 + 64 NuclAT_28 - Antitoxin
- 4119844..4119907 + 64 NuclAT_28 - Antitoxin
- 4119844..4119907 + 64 NuclAT_28 - Antitoxin
- 4119844..4119909 + 66 NuclAT_13 - -
- 4119844..4119909 + 66 NuclAT_13 - -
- 4119844..4119909 + 66 NuclAT_13 - -
- 4119844..4119909 + 66 NuclAT_13 - -
- 4119844..4119909 + 66 NuclAT_16 - -
- 4119844..4119909 + 66 NuclAT_16 - -
- 4119844..4119909 + 66 NuclAT_16 - -
- 4119844..4119909 + 66 NuclAT_16 - -
HVY30_RS19880 4120171..4120278 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4120327..4120390 + 64 NuclAT_18 - -
- 4120327..4120390 + 64 NuclAT_18 - -
- 4120327..4120390 + 64 NuclAT_18 - -
- 4120327..4120390 + 64 NuclAT_18 - -
- 4120327..4120390 + 64 NuclAT_21 - -
- 4120327..4120390 + 64 NuclAT_21 - -
- 4120327..4120390 + 64 NuclAT_21 - -
- 4120327..4120390 + 64 NuclAT_21 - -
- 4120327..4120390 + 64 NuclAT_24 - -
- 4120327..4120390 + 64 NuclAT_24 - -
- 4120327..4120390 + 64 NuclAT_24 - -
- 4120327..4120390 + 64 NuclAT_24 - -
- 4120327..4120390 + 64 NuclAT_27 - -
- 4120327..4120390 + 64 NuclAT_27 - -
- 4120327..4120390 + 64 NuclAT_27 - -
- 4120327..4120390 + 64 NuclAT_27 - -
- 4120327..4120392 + 66 NuclAT_12 - -
- 4120327..4120392 + 66 NuclAT_12 - -
- 4120327..4120392 + 66 NuclAT_12 - -
- 4120327..4120392 + 66 NuclAT_12 - -
- 4120327..4120392 + 66 NuclAT_15 - -
- 4120327..4120392 + 66 NuclAT_15 - -
- 4120327..4120392 + 66 NuclAT_15 - -
- 4120327..4120392 + 66 NuclAT_15 - -
HVY30_RS19885 4120714..4121910 + 1197 WP_001016304.1 methionine gamma-lyase -
HVY30_RS19890 4122160..4123458 + 1299 WP_181667967.1 amino acid permease -
HVY30_RS19895 4123474..4124685 - 1212 WP_181667968.1 sigma 54-interacting transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T165306 WP_000170738.1 NZ_CP057458:c4119795-4119688 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp

>T165306 NZ_CP073797:c584668-584393 [Dactylosporangium matsuzakiense]
ATGCGCACGATGAGCTACTCCGAGGTCAGGCAGAATCTGGCTAAGGTCTTGGACCAGGTCGTCGACGACGCCGAGGAAGT
CGTGGTCACACGCTCCGGCCACGAGGCAGCGGTCATCATCTCGTTGCGCGAATACGAGTCGCTGAAGGAGACGGCCTACC
TGATGGCCAGCCCTGCGAACGCCCGCCGGCTGAATGACGCCATCGAGGAGCTCCGCACCGGCGGCGGCGAAGTCCACGAC
CTGATCGACCCGGACGGCAACACGGCGGCGGCGTGA

Antitoxin


Download         Length: 64 bp

>AT165306 NZ_CP057458:4119844-4119907 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829L523

Antitoxin

Download structure file

References