Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-timR/Ldr(toxin) |
Location | 4119688..4119907 | Replicon | chromosome |
Accession | NZ_CP057458 | ||
Organism | Escherichia fergusonii strain RHB26-C09 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | A0A829L523 |
Locus tag | HVY30_RS19875 | Protein ID | WP_000170738.1 |
Coordinates | 4119688..4119795 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | timR | ||
Locus tag | - | ||
Coordinates | 4119844..4119907 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HVY30_RS19845 | 4114738..4114926 | - | 189 | WP_001063310.1 | YhjR family protein | - |
HVY30_RS19850 | 4115213..4116772 | + | 1560 | WP_001070267.1 | cellulose biosynthesis protein BcsE | - |
HVY30_RS19855 | 4116769..4116960 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
HVY30_RS19860 | 4116957..4118636 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
HVY30_RS19865 | 4118723..4118830 | - | 108 | WP_114091462.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 4118888..4118942 | + | 55 | NuclAT_20 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_20 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_20 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_20 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_23 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_23 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_23 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_23 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_26 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_26 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_26 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_26 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_29 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_29 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_29 | - | - |
- | 4118888..4118942 | + | 55 | NuclAT_29 | - | - |
- | 4118888..4118944 | + | 57 | NuclAT_14 | - | - |
- | 4118888..4118944 | + | 57 | NuclAT_14 | - | - |
- | 4118888..4118944 | + | 57 | NuclAT_14 | - | - |
- | 4118888..4118944 | + | 57 | NuclAT_14 | - | - |
- | 4118888..4118944 | + | 57 | NuclAT_17 | - | - |
- | 4118888..4118944 | + | 57 | NuclAT_17 | - | - |
- | 4118888..4118944 | + | 57 | NuclAT_17 | - | - |
- | 4118888..4118944 | + | 57 | NuclAT_17 | - | - |
HVY30_RS19870 | 4119206..4119313 | - | 108 | WP_072132476.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
HVY30_RS19875 | 4119688..4119795 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4119844..4119907 | + | 64 | NuclAT_19 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_19 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_19 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_19 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_22 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_22 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_22 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_22 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_25 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_25 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_25 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_25 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_28 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_28 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_28 | - | Antitoxin |
- | 4119844..4119907 | + | 64 | NuclAT_28 | - | Antitoxin |
- | 4119844..4119909 | + | 66 | NuclAT_13 | - | - |
- | 4119844..4119909 | + | 66 | NuclAT_13 | - | - |
- | 4119844..4119909 | + | 66 | NuclAT_13 | - | - |
- | 4119844..4119909 | + | 66 | NuclAT_13 | - | - |
- | 4119844..4119909 | + | 66 | NuclAT_16 | - | - |
- | 4119844..4119909 | + | 66 | NuclAT_16 | - | - |
- | 4119844..4119909 | + | 66 | NuclAT_16 | - | - |
- | 4119844..4119909 | + | 66 | NuclAT_16 | - | - |
HVY30_RS19880 | 4120171..4120278 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 4120327..4120390 | + | 64 | NuclAT_18 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_18 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_18 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_18 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_21 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_21 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_21 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_21 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_24 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_24 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_24 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_24 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_27 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_27 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_27 | - | - |
- | 4120327..4120390 | + | 64 | NuclAT_27 | - | - |
- | 4120327..4120392 | + | 66 | NuclAT_12 | - | - |
- | 4120327..4120392 | + | 66 | NuclAT_12 | - | - |
- | 4120327..4120392 | + | 66 | NuclAT_12 | - | - |
- | 4120327..4120392 | + | 66 | NuclAT_12 | - | - |
- | 4120327..4120392 | + | 66 | NuclAT_15 | - | - |
- | 4120327..4120392 | + | 66 | NuclAT_15 | - | - |
- | 4120327..4120392 | + | 66 | NuclAT_15 | - | - |
- | 4120327..4120392 | + | 66 | NuclAT_15 | - | - |
HVY30_RS19885 | 4120714..4121910 | + | 1197 | WP_001016304.1 | methionine gamma-lyase | - |
HVY30_RS19890 | 4122160..4123458 | + | 1299 | WP_181667967.1 | amino acid permease | - |
HVY30_RS19895 | 4123474..4124685 | - | 1212 | WP_181667968.1 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T165306 WP_000170738.1 NZ_CP057458:c4119795-4119688 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
>T165306 NZ_CP073797:c584668-584393 [Dactylosporangium matsuzakiense]
ATGCGCACGATGAGCTACTCCGAGGTCAGGCAGAATCTGGCTAAGGTCTTGGACCAGGTCGTCGACGACGCCGAGGAAGT
CGTGGTCACACGCTCCGGCCACGAGGCAGCGGTCATCATCTCGTTGCGCGAATACGAGTCGCTGAAGGAGACGGCCTACC
TGATGGCCAGCCCTGCGAACGCCCGCCGGCTGAATGACGCCATCGAGGAGCTCCGCACCGGCGGCGGCGAAGTCCACGAC
CTGATCGACCCGGACGGCAACACGGCGGCGGCGTGA
ATGCGCACGATGAGCTACTCCGAGGTCAGGCAGAATCTGGCTAAGGTCTTGGACCAGGTCGTCGACGACGCCGAGGAAGT
CGTGGTCACACGCTCCGGCCACGAGGCAGCGGTCATCATCTCGTTGCGCGAATACGAGTCGCTGAAGGAGACGGCCTACC
TGATGGCCAGCCCTGCGAACGCCCGCCGGCTGAATGACGCCATCGAGGAGCTCCGCACCGGCGGCGGCGAAGTCCACGAC
CTGATCGACCCGGACGGCAACACGGCGGCGGCGTGA
Antitoxin
Download Length: 64 bp
>AT165306 NZ_CP057458:4119844-4119907 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|