Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 2660374..2660593 Replicon chromosome
Accession NZ_CP057357
Organism Escherichia fergusonii strain RHB28-C21

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag HVY57_RS12945 Protein ID WP_001295224.1
Coordinates 2660374..2660481 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 2660530..2660593 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HVY57_RS12915 2655427..2656986 + 1560 WP_001070267.1 cellulose biosynthesis protein BcsE -
HVY57_RS12920 2656983..2657174 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
HVY57_RS12925 2657171..2658850 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
HVY57_RS12930 2658937..2659044 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2659102..2659156 + 55 NuclAT_20 - -
- 2659102..2659156 + 55 NuclAT_20 - -
- 2659102..2659156 + 55 NuclAT_20 - -
- 2659102..2659156 + 55 NuclAT_20 - -
- 2659102..2659156 + 55 NuclAT_23 - -
- 2659102..2659156 + 55 NuclAT_23 - -
- 2659102..2659156 + 55 NuclAT_23 - -
- 2659102..2659156 + 55 NuclAT_23 - -
- 2659102..2659156 + 55 NuclAT_26 - -
- 2659102..2659156 + 55 NuclAT_26 - -
- 2659102..2659156 + 55 NuclAT_26 - -
- 2659102..2659156 + 55 NuclAT_26 - -
- 2659102..2659156 + 55 NuclAT_29 - -
- 2659102..2659156 + 55 NuclAT_29 - -
- 2659102..2659156 + 55 NuclAT_29 - -
- 2659102..2659156 + 55 NuclAT_29 - -
- 2659102..2659158 + 57 NuclAT_14 - -
- 2659102..2659158 + 57 NuclAT_14 - -
- 2659102..2659158 + 57 NuclAT_14 - -
- 2659102..2659158 + 57 NuclAT_14 - -
- 2659102..2659158 + 57 NuclAT_17 - -
- 2659102..2659158 + 57 NuclAT_17 - -
- 2659102..2659158 + 57 NuclAT_17 - -
- 2659102..2659158 + 57 NuclAT_17 - -
HVY57_RS12935 2659420..2659527 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
HVY57_RS12940 2659902..2660009 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2660058..2660121 + 64 NuclAT_19 - -
- 2660058..2660121 + 64 NuclAT_19 - -
- 2660058..2660121 + 64 NuclAT_19 - -
- 2660058..2660121 + 64 NuclAT_19 - -
- 2660058..2660121 + 64 NuclAT_22 - -
- 2660058..2660121 + 64 NuclAT_22 - -
- 2660058..2660121 + 64 NuclAT_22 - -
- 2660058..2660121 + 64 NuclAT_22 - -
- 2660058..2660121 + 64 NuclAT_25 - -
- 2660058..2660121 + 64 NuclAT_25 - -
- 2660058..2660121 + 64 NuclAT_25 - -
- 2660058..2660121 + 64 NuclAT_25 - -
- 2660058..2660121 + 64 NuclAT_28 - -
- 2660058..2660121 + 64 NuclAT_28 - -
- 2660058..2660121 + 64 NuclAT_28 - -
- 2660058..2660121 + 64 NuclAT_28 - -
- 2660058..2660123 + 66 NuclAT_13 - -
- 2660058..2660123 + 66 NuclAT_13 - -
- 2660058..2660123 + 66 NuclAT_13 - -
- 2660058..2660123 + 66 NuclAT_13 - -
- 2660058..2660123 + 66 NuclAT_16 - -
- 2660058..2660123 + 66 NuclAT_16 - -
- 2660058..2660123 + 66 NuclAT_16 - -
- 2660058..2660123 + 66 NuclAT_16 - -
HVY57_RS12945 2660374..2660481 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2660530..2660593 + 64 NuclAT_18 - Antitoxin
- 2660530..2660593 + 64 NuclAT_18 - Antitoxin
- 2660530..2660593 + 64 NuclAT_18 - Antitoxin
- 2660530..2660593 + 64 NuclAT_18 - Antitoxin
- 2660530..2660593 + 64 NuclAT_21 - Antitoxin
- 2660530..2660593 + 64 NuclAT_21 - Antitoxin
- 2660530..2660593 + 64 NuclAT_21 - Antitoxin
- 2660530..2660593 + 64 NuclAT_21 - Antitoxin
- 2660530..2660593 + 64 NuclAT_24 - Antitoxin
- 2660530..2660593 + 64 NuclAT_24 - Antitoxin
- 2660530..2660593 + 64 NuclAT_24 - Antitoxin
- 2660530..2660593 + 64 NuclAT_24 - Antitoxin
- 2660530..2660593 + 64 NuclAT_27 - Antitoxin
- 2660530..2660593 + 64 NuclAT_27 - Antitoxin
- 2660530..2660593 + 64 NuclAT_27 - Antitoxin
- 2660530..2660593 + 64 NuclAT_27 - Antitoxin
- 2660530..2660595 + 66 NuclAT_12 - -
- 2660530..2660595 + 66 NuclAT_12 - -
- 2660530..2660595 + 66 NuclAT_12 - -
- 2660530..2660595 + 66 NuclAT_12 - -
- 2660530..2660595 + 66 NuclAT_15 - -
- 2660530..2660595 + 66 NuclAT_15 - -
- 2660530..2660595 + 66 NuclAT_15 - -
- 2660530..2660595 + 66 NuclAT_15 - -
HVY57_RS12950 2660917..2662113 + 1197 WP_046082930.1 methionine gamma-lyase -
HVY57_RS12955 2662363..2663661 + 1299 WP_001152711.1 amino acid permease -
HVY57_RS12960 2663677..2664888 - 1212 WP_000256500.1 sigma 54-interacting transcriptional regulator -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T165277 WP_001295224.1 NZ_CP057357:c2660481-2660374 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T165277 NZ_CP073785:17676-18092 [Klebsiella pneumoniae]
GTGAACAAGACCTATATGCTCGACACCTGTATCTGCTCGTTCATCATGCGCGAGCAGCCGGAAGCCGTCCTGAAGCGCCT
GGAGCAGGCGGTGCTGCGCGGCCAGCGCATCGTTGTCTCGGCCATCACTTATTCTGAAATGCGCTTCGGGGCCACCGGCC
CGAAGGCCTCCCCGCGCCACGTCGAGCTGGTCGACGCGTTCTGCGCCCGCCTCGATGCCATCCTGCCCTGGGATCGCGCT
GCGGTGGACGCCACCACGGAGATTAAGGTGGCGCTGCGAATGGCCGGGACGCCGATCGGCCCGAACGACACGGCCATTGC
CGGGCACGCCATCGCCGCCGGTGCCGTGCTGGTGACGAATAATACGCGGGAATTTGAGCGGGTACCGGGTCTTGTGCTGG
AAGACTGGGTAAGATAA

Antitoxin


Download         Length: 64 bp

>AT165277 NZ_CP057357:2660530-2660593 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGAATACCTGCAACGTGCGGGGGTTTT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7


Antitoxin

Download structure file

References