Detailed information of TA system TA165275

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokC/Ldr(toxin)
• Location: 2659902..2660121
• Replicon: chromosome
• Accession: NZ_CP057357
• Organism: Escherichia fergusonii strain RHB28-C21

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A829L523
• Locus tag: HVY57_RS12940
• Protein ID: WP_000170738.1
• Coordinates: 2659902..2660009 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokC
Locus tag	-
Coordinates	2660058..2660121 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HVY57_RS12910	2654952..2655140	-	189	WP_001063310.1	YhjR family protein	-
HVY57_RS12915	2655427..2656986	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HVY57_RS12920	2656983..2657174	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
HVY57_RS12925	2657171..2658850	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HVY57_RS12930	2658937..2659044	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2659102..2659156	+	55	NuclAT_20	-	-
-	2659102..2659156	+	55	NuclAT_20	-	-
-	2659102..2659156	+	55	NuclAT_20	-	-
-	2659102..2659156	+	55	NuclAT_20	-	-
-	2659102..2659156	+	55	NuclAT_23	-	-
-	2659102..2659156	+	55	NuclAT_23	-	-
-	2659102..2659156	+	55	NuclAT_23	-	-
-	2659102..2659156	+	55	NuclAT_23	-	-
-	2659102..2659156	+	55	NuclAT_26	-	-
-	2659102..2659156	+	55	NuclAT_26	-	-
-	2659102..2659156	+	55	NuclAT_26	-	-
-	2659102..2659156	+	55	NuclAT_26	-	-
-	2659102..2659156	+	55	NuclAT_29	-	-
-	2659102..2659156	+	55	NuclAT_29	-	-
-	2659102..2659156	+	55	NuclAT_29	-	-
-	2659102..2659156	+	55	NuclAT_29	-	-
-	2659102..2659158	+	57	NuclAT_14	-	-
-	2659102..2659158	+	57	NuclAT_14	-	-
-	2659102..2659158	+	57	NuclAT_14	-	-
-	2659102..2659158	+	57	NuclAT_14	-	-
-	2659102..2659158	+	57	NuclAT_17	-	-
-	2659102..2659158	+	57	NuclAT_17	-	-
-	2659102..2659158	+	57	NuclAT_17	-	-
-	2659102..2659158	+	57	NuclAT_17	-	-
HVY57_RS12935	2659420..2659527	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
HVY57_RS12940	2659902..2660009	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2660058..2660121	+	64	NuclAT_19	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_19	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_19	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_19	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_22	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_22	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_22	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_22	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_25	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_25	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_25	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_25	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_28	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_28	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_28	-	Antitoxin
-	2660058..2660121	+	64	NuclAT_28	-	Antitoxin
-	2660058..2660123	+	66	NuclAT_13	-	-
-	2660058..2660123	+	66	NuclAT_13	-	-
-	2660058..2660123	+	66	NuclAT_13	-	-
-	2660058..2660123	+	66	NuclAT_13	-	-
-	2660058..2660123	+	66	NuclAT_16	-	-
-	2660058..2660123	+	66	NuclAT_16	-	-
-	2660058..2660123	+	66	NuclAT_16	-	-
-	2660058..2660123	+	66	NuclAT_16	-	-
HVY57_RS12945	2660374..2660481	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2660530..2660593	+	64	NuclAT_18	-	-
-	2660530..2660593	+	64	NuclAT_18	-	-
-	2660530..2660593	+	64	NuclAT_18	-	-
-	2660530..2660593	+	64	NuclAT_18	-	-
-	2660530..2660593	+	64	NuclAT_21	-	-
-	2660530..2660593	+	64	NuclAT_21	-	-
-	2660530..2660593	+	64	NuclAT_21	-	-
-	2660530..2660593	+	64	NuclAT_21	-	-
-	2660530..2660593	+	64	NuclAT_24	-	-
-	2660530..2660593	+	64	NuclAT_24	-	-
-	2660530..2660593	+	64	NuclAT_24	-	-
-	2660530..2660593	+	64	NuclAT_24	-	-
-	2660530..2660593	+	64	NuclAT_27	-	-
-	2660530..2660593	+	64	NuclAT_27	-	-
-	2660530..2660593	+	64	NuclAT_27	-	-
-	2660530..2660593	+	64	NuclAT_27	-	-
-	2660530..2660595	+	66	NuclAT_12	-	-
-	2660530..2660595	+	66	NuclAT_12	-	-
-	2660530..2660595	+	66	NuclAT_12	-	-
-	2660530..2660595	+	66	NuclAT_12	-	-
-	2660530..2660595	+	66	NuclAT_15	-	-
-	2660530..2660595	+	66	NuclAT_15	-	-
-	2660530..2660595	+	66	NuclAT_15	-	-
-	2660530..2660595	+	66	NuclAT_15	-	-
HVY57_RS12950	2660917..2662113	+	1197	WP_046082930.1	methionine gamma-lyase	-
HVY57_RS12955	2662363..2663661	+	1299	WP_001152711.1	amino acid permease	-
HVY57_RS12960	2663677..2664888	-	1212	WP_000256500.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3864.67 Da
• Isoelectric Point: 9.0157

>T165275 WP_000170738.1 NZ_CP057357:c2660009-2659902 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Nucleotide

• Length: 108 bp

>T165275 NZ_CP073784:75096-75566 [Klebsiella pneumoniae]
GTGATCCTCTACAGGCTGACGAAAACAAAGTATCTTTCTACGGCCTGGACCGGATATGGTGCGAAAGAGGCTGGTGGGCG
TTGGAATAGCGTGGGGGTGTCAATGGTATATGTCTCCGAAACGGCATCACTAACGATGCTGGAGACGCTGGTACACCTGC
ATGCGGCACAGATAATGGACTCTTTCACGCTACTGAGTATCGATGTGCCTGATGAACTGATCCAAAGCGCAAACATGGAT
GAATTACCGGGCAACTGGGCTGATGAGGATGCGCCTCAGGAACTGGCTGATTACGGAGATGCCTGGTCATTTACCAGGAG
CTCGGTTGCACTGCGTGTTCCCTCAGCCTTATCGCCGGTAGAGTTCAACTATCTGTTAAATCCTGAGCACCCTGAGTTTT
ACGGGATCGTGCAGAAGGCTCAACAGATACCGTTCCGGTTTGATAGTCGTCTTAAACCTGACAGGAAGTGA

Antitoxin

Nucleotide

• Length: 64 bp

>AT165275 NZ_CP057357:2660058-2660121 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Toxin

• AlphaFold DB: A0A829L523

Antitoxin