Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokX/Ldr(toxin) |
| Location | 2581458..2581677 | Replicon | chromosome |
| Accession | NZ_CP057311 | ||
| Organism | Escherichia fergusonii strain RHB30-C07 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | - |
| Locus tag | HVY75_RS12555 | Protein ID | WP_181202942.1 |
| Coordinates | 2581458..2581565 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokX | ||
| Locus tag | - | ||
| Coordinates | 2581614..2581677 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HVY75_RS12525 | 2576508..2576696 | - | 189 | WP_001063310.1 | YhjR family protein | - |
| HVY75_RS12530 | 2576983..2578542 | + | 1560 | WP_001070267.1 | cellulose biosynthesis protein BcsE | - |
| HVY75_RS12535 | 2578539..2578730 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
| HVY75_RS12540 | 2578727..2580406 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
| HVY75_RS12545 | 2580493..2580600 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2580658..2580712 | + | 55 | NuclAT_24 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_24 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_24 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_24 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_27 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_27 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_27 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_27 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_30 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_30 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_30 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_30 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_33 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_33 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_33 | - | - |
| - | 2580658..2580712 | + | 55 | NuclAT_33 | - | - |
| - | 2580658..2580714 | + | 57 | NuclAT_18 | - | - |
| - | 2580658..2580714 | + | 57 | NuclAT_18 | - | - |
| - | 2580658..2580714 | + | 57 | NuclAT_18 | - | - |
| - | 2580658..2580714 | + | 57 | NuclAT_18 | - | - |
| - | 2580658..2580714 | + | 57 | NuclAT_21 | - | - |
| - | 2580658..2580714 | + | 57 | NuclAT_21 | - | - |
| - | 2580658..2580714 | + | 57 | NuclAT_21 | - | - |
| - | 2580658..2580714 | + | 57 | NuclAT_21 | - | - |
| HVY75_RS12550 | 2580976..2581083 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2581132..2581195 | + | 64 | NuclAT_23 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_23 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_23 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_23 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_26 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_26 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_26 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_26 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_29 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_29 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_29 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_29 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_32 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_32 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_32 | - | - |
| - | 2581132..2581195 | + | 64 | NuclAT_32 | - | - |
| - | 2581132..2581197 | + | 66 | NuclAT_17 | - | - |
| - | 2581132..2581197 | + | 66 | NuclAT_17 | - | - |
| - | 2581132..2581197 | + | 66 | NuclAT_17 | - | - |
| - | 2581132..2581197 | + | 66 | NuclAT_17 | - | - |
| - | 2581132..2581197 | + | 66 | NuclAT_20 | - | - |
| - | 2581132..2581197 | + | 66 | NuclAT_20 | - | - |
| - | 2581132..2581197 | + | 66 | NuclAT_20 | - | - |
| - | 2581132..2581197 | + | 66 | NuclAT_20 | - | - |
| HVY75_RS12555 | 2581458..2581565 | - | 108 | WP_181202942.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2581614..2581677 | + | 64 | NuclAT_22 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_22 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_22 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_22 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_25 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_25 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_25 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_25 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_28 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_28 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_28 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_28 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_31 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_31 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_31 | - | Antitoxin |
| - | 2581614..2581677 | + | 64 | NuclAT_31 | - | Antitoxin |
| - | 2581614..2581679 | + | 66 | NuclAT_16 | - | - |
| - | 2581614..2581679 | + | 66 | NuclAT_16 | - | - |
| - | 2581614..2581679 | + | 66 | NuclAT_16 | - | - |
| - | 2581614..2581679 | + | 66 | NuclAT_16 | - | - |
| - | 2581614..2581679 | + | 66 | NuclAT_19 | - | - |
| - | 2581614..2581679 | + | 66 | NuclAT_19 | - | - |
| - | 2581614..2581679 | + | 66 | NuclAT_19 | - | - |
| - | 2581614..2581679 | + | 66 | NuclAT_19 | - | - |
| HVY75_RS12560 | 2582002..2583198 | + | 1197 | WP_181202943.1 | methionine gamma-lyase | - |
| HVY75_RS12565 | 2583447..2584745 | + | 1299 | WP_181202944.1 | amino acid permease | - |
| HVY75_RS12570 | 2584761..2585972 | - | 1212 | WP_181202945.1 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3850.60 Da Isoelectric Point: 7.0027
>T165187 WP_181202942.1 NZ_CP057311:c2581565-2581458 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRN
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRN
Download Length: 108 bp
>T165187 NZ_CP073751:c2494144-2493881 [Halopseudomonas nanhaiensis]
GTGACATGGAAGTTGGTTTACACCAAACAAGCCCAGAAGGACGCAAAGAAGCTGGCTTCCAGCGGCCTCAAGCCAAAAGC
CCAAGAGTTGTTGGCACTAATTGCAGAAAATCCGTACCGCAAGCCGCCCCCGTTTGAGAAGCTCATTGGTGATCTTGCGG
GTGCCTATTCCCGCCGCATCAATATCCAGCACCGCCTGGTATACCAAGTGCTCGAAGACGAAAAAGTGGTAAAAGTCCTC
CGCCTCTGGAGCCACTACGAATAA
GTGACATGGAAGTTGGTTTACACCAAACAAGCCCAGAAGGACGCAAAGAAGCTGGCTTCCAGCGGCCTCAAGCCAAAAGC
CCAAGAGTTGTTGGCACTAATTGCAGAAAATCCGTACCGCAAGCCGCCCCCGTTTGAGAAGCTCATTGGTGATCTTGCGG
GTGCCTATTCCCGCCGCATCAATATCCAGCACCGCCTGGTATACCAAGTGCTCGAAGACGAAAAAGTGGTAAAAGTCCTC
CGCCTCTGGAGCCACTACGAATAA
Antitoxin
Download Length: 64 bp
>AT165187 NZ_CP057311:2581614-2581677 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGAATACCTGCAACGTGCGGGGGTTTT
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGAATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|