Detailed information of TA system TA165187

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokX/Ldr(toxin)
• Location: 2581458..2581677
• Replicon: chromosome
• Accession: NZ_CP057311
• Organism: Escherichia fergusonii strain RHB30-C07

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: -
• Locus tag: HVY75_RS12555
• Protein ID: WP_181202942.1
• Coordinates: 2581458..2581565 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokX
Locus tag	-
Coordinates	2581614..2581677 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HVY75_RS12525	2576508..2576696	-	189	WP_001063310.1	YhjR family protein	-
HVY75_RS12530	2576983..2578542	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HVY75_RS12535	2578539..2578730	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
HVY75_RS12540	2578727..2580406	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HVY75_RS12545	2580493..2580600	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2580658..2580712	+	55	NuclAT_24	-	-
-	2580658..2580712	+	55	NuclAT_24	-	-
-	2580658..2580712	+	55	NuclAT_24	-	-
-	2580658..2580712	+	55	NuclAT_24	-	-
-	2580658..2580712	+	55	NuclAT_27	-	-
-	2580658..2580712	+	55	NuclAT_27	-	-
-	2580658..2580712	+	55	NuclAT_27	-	-
-	2580658..2580712	+	55	NuclAT_27	-	-
-	2580658..2580712	+	55	NuclAT_30	-	-
-	2580658..2580712	+	55	NuclAT_30	-	-
-	2580658..2580712	+	55	NuclAT_30	-	-
-	2580658..2580712	+	55	NuclAT_30	-	-
-	2580658..2580712	+	55	NuclAT_33	-	-
-	2580658..2580712	+	55	NuclAT_33	-	-
-	2580658..2580712	+	55	NuclAT_33	-	-
-	2580658..2580712	+	55	NuclAT_33	-	-
-	2580658..2580714	+	57	NuclAT_18	-	-
-	2580658..2580714	+	57	NuclAT_18	-	-
-	2580658..2580714	+	57	NuclAT_18	-	-
-	2580658..2580714	+	57	NuclAT_18	-	-
-	2580658..2580714	+	57	NuclAT_21	-	-
-	2580658..2580714	+	57	NuclAT_21	-	-
-	2580658..2580714	+	57	NuclAT_21	-	-
-	2580658..2580714	+	57	NuclAT_21	-	-
HVY75_RS12550	2580976..2581083	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2581132..2581195	+	64	NuclAT_23	-	-
-	2581132..2581195	+	64	NuclAT_23	-	-
-	2581132..2581195	+	64	NuclAT_23	-	-
-	2581132..2581195	+	64	NuclAT_23	-	-
-	2581132..2581195	+	64	NuclAT_26	-	-
-	2581132..2581195	+	64	NuclAT_26	-	-
-	2581132..2581195	+	64	NuclAT_26	-	-
-	2581132..2581195	+	64	NuclAT_26	-	-
-	2581132..2581195	+	64	NuclAT_29	-	-
-	2581132..2581195	+	64	NuclAT_29	-	-
-	2581132..2581195	+	64	NuclAT_29	-	-
-	2581132..2581195	+	64	NuclAT_29	-	-
-	2581132..2581195	+	64	NuclAT_32	-	-
-	2581132..2581195	+	64	NuclAT_32	-	-
-	2581132..2581195	+	64	NuclAT_32	-	-
-	2581132..2581195	+	64	NuclAT_32	-	-
-	2581132..2581197	+	66	NuclAT_17	-	-
-	2581132..2581197	+	66	NuclAT_17	-	-
-	2581132..2581197	+	66	NuclAT_17	-	-
-	2581132..2581197	+	66	NuclAT_17	-	-
-	2581132..2581197	+	66	NuclAT_20	-	-
-	2581132..2581197	+	66	NuclAT_20	-	-
-	2581132..2581197	+	66	NuclAT_20	-	-
-	2581132..2581197	+	66	NuclAT_20	-	-
HVY75_RS12555	2581458..2581565	-	108	WP_181202942.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2581614..2581677	+	64	NuclAT_22	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_22	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_22	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_22	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_25	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_25	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_25	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_25	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_28	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_28	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_28	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_28	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_31	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_31	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_31	-	Antitoxin
-	2581614..2581677	+	64	NuclAT_31	-	Antitoxin
-	2581614..2581679	+	66	NuclAT_16	-	-
-	2581614..2581679	+	66	NuclAT_16	-	-
-	2581614..2581679	+	66	NuclAT_16	-	-
-	2581614..2581679	+	66	NuclAT_16	-	-
-	2581614..2581679	+	66	NuclAT_19	-	-
-	2581614..2581679	+	66	NuclAT_19	-	-
-	2581614..2581679	+	66	NuclAT_19	-	-
-	2581614..2581679	+	66	NuclAT_19	-	-
HVY75_RS12560	2582002..2583198	+	1197	WP_181202943.1	methionine gamma-lyase	-
HVY75_RS12565	2583447..2584745	+	1299	WP_181202944.1	amino acid permease	-
HVY75_RS12570	2584761..2585972	-	1212	WP_181202945.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-34)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3850.60 Da
• Isoelectric Point: 7.0027

>T165187 WP_181202942.1 NZ_CP057311:c2581565-2581458 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRN

Nucleotide

• Length: 108 bp

>T165187 NZ_CP073751:c2494144-2493881 [Halopseudomonas nanhaiensis]
GTGACATGGAAGTTGGTTTACACCAAACAAGCCCAGAAGGACGCAAAGAAGCTGGCTTCCAGCGGCCTCAAGCCAAAAGC
CCAAGAGTTGTTGGCACTAATTGCAGAAAATCCGTACCGCAAGCCGCCCCCGTTTGAGAAGCTCATTGGTGATCTTGCGG
GTGCCTATTCCCGCCGCATCAATATCCAGCACCGCCTGGTATACCAAGTGCTCGAAGACGAAAAAGTGGTAAAAGTCCTC
CGCCTCTGGAGCCACTACGAATAA

Antitoxin

Nucleotide

• Length: 64 bp

>AT165187 NZ_CP057311:2581614-2581677 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGAATACCTGCAACGTGCGGGGGTTTT

Structures

Antitoxin