Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-symR/Ldr(toxin) |
| Location | 2584268..2584487 | Replicon | chromosome |
| Accession | NZ_CP057266 | ||
| Organism | Escherichia fergusonii strain RHB31-C13 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | HVY87_RS12650 | Protein ID | WP_001295224.1 |
| Coordinates | 2584268..2584375 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 2584424..2584487 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HVY87_RS12620 | 2579310..2580869 | + | 1560 | WP_001070267.1 | cellulose biosynthesis protein BcsE | - |
| HVY87_RS12625 | 2580866..2581057 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
| HVY87_RS12630 | 2581054..2582733 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
| HVY87_RS12635 | 2582820..2582927 | - | 108 | WP_149012441.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2582985..2583039 | + | 55 | NuclAT_22 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_22 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_22 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_22 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_25 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_25 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_25 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_25 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_28 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_28 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_28 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_28 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_31 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_31 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_31 | - | - |
| - | 2582985..2583039 | + | 55 | NuclAT_31 | - | - |
| - | 2582985..2583041 | + | 57 | NuclAT_15 | - | - |
| - | 2582985..2583041 | + | 57 | NuclAT_15 | - | - |
| - | 2582985..2583041 | + | 57 | NuclAT_15 | - | - |
| - | 2582985..2583041 | + | 57 | NuclAT_15 | - | - |
| - | 2582985..2583041 | + | 57 | NuclAT_18 | - | - |
| - | 2582985..2583041 | + | 57 | NuclAT_18 | - | - |
| - | 2582985..2583041 | + | 57 | NuclAT_18 | - | - |
| - | 2582985..2583041 | + | 57 | NuclAT_18 | - | - |
| HVY87_RS12640 | 2583303..2583410 | - | 108 | WP_002431793.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| HVY87_RS12645 | 2583785..2583892 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2583941..2584004 | + | 64 | NuclAT_21 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_21 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_21 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_21 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_24 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_24 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_24 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_24 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_27 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_27 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_27 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_27 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_30 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_30 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_30 | - | - |
| - | 2583941..2584004 | + | 64 | NuclAT_30 | - | - |
| - | 2583941..2584006 | + | 66 | NuclAT_14 | - | - |
| - | 2583941..2584006 | + | 66 | NuclAT_14 | - | - |
| - | 2583941..2584006 | + | 66 | NuclAT_14 | - | - |
| - | 2583941..2584006 | + | 66 | NuclAT_14 | - | - |
| - | 2583941..2584006 | + | 66 | NuclAT_17 | - | - |
| - | 2583941..2584006 | + | 66 | NuclAT_17 | - | - |
| - | 2583941..2584006 | + | 66 | NuclAT_17 | - | - |
| - | 2583941..2584006 | + | 66 | NuclAT_17 | - | - |
| HVY87_RS12650 | 2584268..2584375 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2584424..2584487 | + | 64 | NuclAT_20 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_20 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_20 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_20 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_23 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_23 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_23 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_23 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_26 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_26 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_26 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_26 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_29 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_29 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_29 | - | Antitoxin |
| - | 2584424..2584487 | + | 64 | NuclAT_29 | - | Antitoxin |
| - | 2584424..2584489 | + | 66 | NuclAT_13 | - | - |
| - | 2584424..2584489 | + | 66 | NuclAT_13 | - | - |
| - | 2584424..2584489 | + | 66 | NuclAT_13 | - | - |
| - | 2584424..2584489 | + | 66 | NuclAT_13 | - | - |
| - | 2584424..2584489 | + | 66 | NuclAT_16 | - | - |
| - | 2584424..2584489 | + | 66 | NuclAT_16 | - | - |
| - | 2584424..2584489 | + | 66 | NuclAT_16 | - | - |
| - | 2584424..2584489 | + | 66 | NuclAT_16 | - | - |
| HVY87_RS12655 | 2584811..2586007 | + | 1197 | WP_046082930.1 | methionine gamma-lyase | - |
| HVY87_RS12660 | 2586257..2587555 | + | 1299 | WP_046081028.1 | amino acid permease | - |
| HVY87_RS12665 | 2587571..2588782 | - | 1212 | WP_181672326.1 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T165164 WP_001295224.1 NZ_CP057266:c2584375-2584268 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T165164 NZ_CP073719:c3815618-3815220 [Escherichia coli]
ATGCGGGTATTCAAAACAAAACTTATTCGCCTGCAACTTACAGCAGAGGAACTTGATGCGTTAACGGCGGATTTTATTTC
CTATAAGCGTGACGGTGTTTTGCCAGATATATTTGGTCGCGATGCACTCTACGACGACTCGTTTACCTGGCCATTAATCA
AATTTGAGCGAGTTGCTCATATTCATCTGGCAAATGTGAATAATCCATTTCCGCCACAGTTGCGCCAATTCAGCAGAACG
AATGACGAAGCGCATTTGGTATATTGTCAGGGTGCGTTTGATGAGCAAGCATGGTTGCTCATTGCCATTCTGAAACCTGA
ACCTCATAAACAGGCTCGAGATAACAACCAAATGCATAAAATTGGGAAAATGGCAGAAGCGTTTCGCATGCGTTTTTGA
ATGCGGGTATTCAAAACAAAACTTATTCGCCTGCAACTTACAGCAGAGGAACTTGATGCGTTAACGGCGGATTTTATTTC
CTATAAGCGTGACGGTGTTTTGCCAGATATATTTGGTCGCGATGCACTCTACGACGACTCGTTTACCTGGCCATTAATCA
AATTTGAGCGAGTTGCTCATATTCATCTGGCAAATGTGAATAATCCATTTCCGCCACAGTTGCGCCAATTCAGCAGAACG
AATGACGAAGCGCATTTGGTATATTGTCAGGGTGCGTTTGATGAGCAAGCATGGTTGCTCATTGCCATTCTGAAACCTGA
ACCTCATAAACAGGCTCGAGATAACAACCAAATGCATAAAATTGGGAAAATGGCAGAAGCGTTTCGCATGCGTTTTTGA
Antitoxin
Download Length: 64 bp
>AT165164 NZ_CP057266:2584424-2584487 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|