Detailed information of TA system TA165164

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-symR/Ldr(toxin)
• Location: 2584268..2584487
• Replicon: chromosome
• Accession: NZ_CP057266
• Organism: Escherichia fergusonii strain RHB31-C13

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: S1NWX0
• Locus tag: HVY87_RS12650
• Protein ID: WP_001295224.1
• Coordinates: 2584268..2584375 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	symR
Locus tag	-
Coordinates	2584424..2584487 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HVY87_RS12620	2579310..2580869	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HVY87_RS12625	2580866..2581057	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
HVY87_RS12630	2581054..2582733	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HVY87_RS12635	2582820..2582927	-	108	WP_149012441.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2582985..2583039	+	55	NuclAT_22	-	-
-	2582985..2583039	+	55	NuclAT_22	-	-
-	2582985..2583039	+	55	NuclAT_22	-	-
-	2582985..2583039	+	55	NuclAT_22	-	-
-	2582985..2583039	+	55	NuclAT_25	-	-
-	2582985..2583039	+	55	NuclAT_25	-	-
-	2582985..2583039	+	55	NuclAT_25	-	-
-	2582985..2583039	+	55	NuclAT_25	-	-
-	2582985..2583039	+	55	NuclAT_28	-	-
-	2582985..2583039	+	55	NuclAT_28	-	-
-	2582985..2583039	+	55	NuclAT_28	-	-
-	2582985..2583039	+	55	NuclAT_28	-	-
-	2582985..2583039	+	55	NuclAT_31	-	-
-	2582985..2583039	+	55	NuclAT_31	-	-
-	2582985..2583039	+	55	NuclAT_31	-	-
-	2582985..2583039	+	55	NuclAT_31	-	-
-	2582985..2583041	+	57	NuclAT_15	-	-
-	2582985..2583041	+	57	NuclAT_15	-	-
-	2582985..2583041	+	57	NuclAT_15	-	-
-	2582985..2583041	+	57	NuclAT_15	-	-
-	2582985..2583041	+	57	NuclAT_18	-	-
-	2582985..2583041	+	57	NuclAT_18	-	-
-	2582985..2583041	+	57	NuclAT_18	-	-
-	2582985..2583041	+	57	NuclAT_18	-	-
HVY87_RS12640	2583303..2583410	-	108	WP_002431793.1	type I toxin-antitoxin system toxin Ldr family protein	-
HVY87_RS12645	2583785..2583892	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2583941..2584004	+	64	NuclAT_21	-	-
-	2583941..2584004	+	64	NuclAT_21	-	-
-	2583941..2584004	+	64	NuclAT_21	-	-
-	2583941..2584004	+	64	NuclAT_21	-	-
-	2583941..2584004	+	64	NuclAT_24	-	-
-	2583941..2584004	+	64	NuclAT_24	-	-
-	2583941..2584004	+	64	NuclAT_24	-	-
-	2583941..2584004	+	64	NuclAT_24	-	-
-	2583941..2584004	+	64	NuclAT_27	-	-
-	2583941..2584004	+	64	NuclAT_27	-	-
-	2583941..2584004	+	64	NuclAT_27	-	-
-	2583941..2584004	+	64	NuclAT_27	-	-
-	2583941..2584004	+	64	NuclAT_30	-	-
-	2583941..2584004	+	64	NuclAT_30	-	-
-	2583941..2584004	+	64	NuclAT_30	-	-
-	2583941..2584004	+	64	NuclAT_30	-	-
-	2583941..2584006	+	66	NuclAT_14	-	-
-	2583941..2584006	+	66	NuclAT_14	-	-
-	2583941..2584006	+	66	NuclAT_14	-	-
-	2583941..2584006	+	66	NuclAT_14	-	-
-	2583941..2584006	+	66	NuclAT_17	-	-
-	2583941..2584006	+	66	NuclAT_17	-	-
-	2583941..2584006	+	66	NuclAT_17	-	-
-	2583941..2584006	+	66	NuclAT_17	-	-
HVY87_RS12650	2584268..2584375	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2584424..2584487	+	64	NuclAT_20	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_20	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_20	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_20	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_23	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_23	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_23	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_23	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_26	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_26	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_26	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_26	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_29	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_29	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_29	-	Antitoxin
-	2584424..2584487	+	64	NuclAT_29	-	Antitoxin
-	2584424..2584489	+	66	NuclAT_13	-	-
-	2584424..2584489	+	66	NuclAT_13	-	-
-	2584424..2584489	+	66	NuclAT_13	-	-
-	2584424..2584489	+	66	NuclAT_13	-	-
-	2584424..2584489	+	66	NuclAT_16	-	-
-	2584424..2584489	+	66	NuclAT_16	-	-
-	2584424..2584489	+	66	NuclAT_16	-	-
-	2584424..2584489	+	66	NuclAT_16	-	-
HVY87_RS12655	2584811..2586007	+	1197	WP_046082930.1	methionine gamma-lyase	-
HVY87_RS12660	2586257..2587555	+	1299	WP_046081028.1	amino acid permease	-
HVY87_RS12665	2587571..2588782	-	1212	WP_181672326.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3882.70 Da
• Isoelectric Point: 9.0157

>T165164 WP_001295224.1 NZ_CP057266:c2584375-2584268 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Nucleotide

• Length: 108 bp

>T165164 NZ_CP073719:c3815618-3815220 [Escherichia coli]
ATGCGGGTATTCAAAACAAAACTTATTCGCCTGCAACTTACAGCAGAGGAACTTGATGCGTTAACGGCGGATTTTATTTC
CTATAAGCGTGACGGTGTTTTGCCAGATATATTTGGTCGCGATGCACTCTACGACGACTCGTTTACCTGGCCATTAATCA
AATTTGAGCGAGTTGCTCATATTCATCTGGCAAATGTGAATAATCCATTTCCGCCACAGTTGCGCCAATTCAGCAGAACG
AATGACGAAGCGCATTTGGTATATTGTCAGGGTGCGTTTGATGAGCAAGCATGGTTGCTCATTGCCATTCTGAAACCTGA
ACCTCATAAACAGGCTCGAGATAACAACCAAATGCATAAAATTGGGAAAATGGCAGAAGCGTTTCGCATGCGTTTTTGA

Antitoxin

Nucleotide

• Length: 64 bp

>AT165164 NZ_CP057266:2584424-2584487 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Toxin

• AlphaFold DB: A0A4P7TSJ7

Antitoxin