Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 2509097..2509316 Replicon chromosome
Accession NZ_CP057256
Organism Escherichia fergusonii strain RHB31-C17

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag HVY91_RS12195 Protein ID WP_001295224.1
Coordinates 2509097..2509204 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 2509253..2509316 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HVY91_RS12165 2504139..2505698 + 1560 WP_001070267.1 cellulose biosynthesis protein BcsE -
HVY91_RS12170 2505695..2505886 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
HVY91_RS12175 2505883..2507562 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
HVY91_RS12180 2507649..2507756 - 108 WP_114091462.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2507814..2507868 + 55 NuclAT_22 - -
- 2507814..2507868 + 55 NuclAT_22 - -
- 2507814..2507868 + 55 NuclAT_22 - -
- 2507814..2507868 + 55 NuclAT_22 - -
- 2507814..2507868 + 55 NuclAT_25 - -
- 2507814..2507868 + 55 NuclAT_25 - -
- 2507814..2507868 + 55 NuclAT_25 - -
- 2507814..2507868 + 55 NuclAT_25 - -
- 2507814..2507868 + 55 NuclAT_28 - -
- 2507814..2507868 + 55 NuclAT_28 - -
- 2507814..2507868 + 55 NuclAT_28 - -
- 2507814..2507868 + 55 NuclAT_28 - -
- 2507814..2507868 + 55 NuclAT_31 - -
- 2507814..2507868 + 55 NuclAT_31 - -
- 2507814..2507868 + 55 NuclAT_31 - -
- 2507814..2507868 + 55 NuclAT_31 - -
- 2507814..2507870 + 57 NuclAT_16 - -
- 2507814..2507870 + 57 NuclAT_16 - -
- 2507814..2507870 + 57 NuclAT_16 - -
- 2507814..2507870 + 57 NuclAT_16 - -
- 2507814..2507870 + 57 NuclAT_19 - -
- 2507814..2507870 + 57 NuclAT_19 - -
- 2507814..2507870 + 57 NuclAT_19 - -
- 2507814..2507870 + 57 NuclAT_19 - -
HVY91_RS12185 2508132..2508239 - 108 WP_072132476.1 type I toxin-antitoxin system toxin Ldr family protein -
HVY91_RS12190 2508614..2508721 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2508770..2508833 + 64 NuclAT_21 - -
- 2508770..2508833 + 64 NuclAT_21 - -
- 2508770..2508833 + 64 NuclAT_21 - -
- 2508770..2508833 + 64 NuclAT_21 - -
- 2508770..2508833 + 64 NuclAT_24 - -
- 2508770..2508833 + 64 NuclAT_24 - -
- 2508770..2508833 + 64 NuclAT_24 - -
- 2508770..2508833 + 64 NuclAT_24 - -
- 2508770..2508833 + 64 NuclAT_27 - -
- 2508770..2508833 + 64 NuclAT_27 - -
- 2508770..2508833 + 64 NuclAT_27 - -
- 2508770..2508833 + 64 NuclAT_27 - -
- 2508770..2508833 + 64 NuclAT_30 - -
- 2508770..2508833 + 64 NuclAT_30 - -
- 2508770..2508833 + 64 NuclAT_30 - -
- 2508770..2508833 + 64 NuclAT_30 - -
- 2508770..2508835 + 66 NuclAT_15 - -
- 2508770..2508835 + 66 NuclAT_15 - -
- 2508770..2508835 + 66 NuclAT_15 - -
- 2508770..2508835 + 66 NuclAT_15 - -
- 2508770..2508835 + 66 NuclAT_18 - -
- 2508770..2508835 + 66 NuclAT_18 - -
- 2508770..2508835 + 66 NuclAT_18 - -
- 2508770..2508835 + 66 NuclAT_18 - -
HVY91_RS12195 2509097..2509204 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2509253..2509316 + 64 NuclAT_20 - Antitoxin
- 2509253..2509316 + 64 NuclAT_20 - Antitoxin
- 2509253..2509316 + 64 NuclAT_20 - Antitoxin
- 2509253..2509316 + 64 NuclAT_20 - Antitoxin
- 2509253..2509316 + 64 NuclAT_23 - Antitoxin
- 2509253..2509316 + 64 NuclAT_23 - Antitoxin
- 2509253..2509316 + 64 NuclAT_23 - Antitoxin
- 2509253..2509316 + 64 NuclAT_23 - Antitoxin
- 2509253..2509316 + 64 NuclAT_26 - Antitoxin
- 2509253..2509316 + 64 NuclAT_26 - Antitoxin
- 2509253..2509316 + 64 NuclAT_26 - Antitoxin
- 2509253..2509316 + 64 NuclAT_26 - Antitoxin
- 2509253..2509316 + 64 NuclAT_29 - Antitoxin
- 2509253..2509316 + 64 NuclAT_29 - Antitoxin
- 2509253..2509316 + 64 NuclAT_29 - Antitoxin
- 2509253..2509316 + 64 NuclAT_29 - Antitoxin
- 2509253..2509318 + 66 NuclAT_14 - -
- 2509253..2509318 + 66 NuclAT_14 - -
- 2509253..2509318 + 66 NuclAT_14 - -
- 2509253..2509318 + 66 NuclAT_14 - -
- 2509253..2509318 + 66 NuclAT_17 - -
- 2509253..2509318 + 66 NuclAT_17 - -
- 2509253..2509318 + 66 NuclAT_17 - -
- 2509253..2509318 + 66 NuclAT_17 - -
HVY91_RS12200 2509640..2510836 + 1197 WP_001016304.1 methionine gamma-lyase -
HVY91_RS12205 2511086..2512384 + 1299 WP_181667967.1 amino acid permease -
HVY91_RS12210 2512400..2513611 - 1212 WP_181667968.1 sigma 54-interacting transcriptional regulator -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T165128 WP_001295224.1 NZ_CP057256:c2509204-2509097 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T165128 NZ_CP073718:186738-186845 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT165128 NZ_CP057256:2509253-2509316 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7


Antitoxin

Download structure file

References