Detailed information of TA system TA165122

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokA/Ldr(toxin)
• Location: 2507649..2507868
• Replicon: chromosome
• Accession: NZ_CP057256
• Organism: Escherichia fergusonii strain RHB31-C17

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: -
• Locus tag: HVY91_RS12180
• Protein ID: WP_114091462.1
• Coordinates: 2507649..2507756 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokA
Locus tag	-
Coordinates	2507814..2507868 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HVY91_RS12155	2502885..2503652	-	768	WP_000279501.1	cellulose biosynthesis protein BcsQ	-
HVY91_RS12160	2503664..2503852	-	189	WP_001063310.1	YhjR family protein	-
HVY91_RS12165	2504139..2505698	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HVY91_RS12170	2505695..2505886	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
HVY91_RS12175	2505883..2507562	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HVY91_RS12180	2507649..2507756	-	108	WP_114091462.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2507814..2507868	+	55	NuclAT_22	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_22	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_22	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_22	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_25	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_25	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_25	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_25	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_28	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_28	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_28	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_28	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_31	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_31	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_31	-	Antitoxin
-	2507814..2507868	+	55	NuclAT_31	-	Antitoxin
-	2507814..2507870	+	57	NuclAT_16	-	-
-	2507814..2507870	+	57	NuclAT_16	-	-
-	2507814..2507870	+	57	NuclAT_16	-	-
-	2507814..2507870	+	57	NuclAT_16	-	-
-	2507814..2507870	+	57	NuclAT_19	-	-
-	2507814..2507870	+	57	NuclAT_19	-	-
-	2507814..2507870	+	57	NuclAT_19	-	-
-	2507814..2507870	+	57	NuclAT_19	-	-
HVY91_RS12185	2508132..2508239	-	108	WP_072132476.1	type I toxin-antitoxin system toxin Ldr family protein	-
HVY91_RS12190	2508614..2508721	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2508770..2508833	+	64	NuclAT_21	-	-
-	2508770..2508833	+	64	NuclAT_21	-	-
-	2508770..2508833	+	64	NuclAT_21	-	-
-	2508770..2508833	+	64	NuclAT_21	-	-
-	2508770..2508833	+	64	NuclAT_24	-	-
-	2508770..2508833	+	64	NuclAT_24	-	-
-	2508770..2508833	+	64	NuclAT_24	-	-
-	2508770..2508833	+	64	NuclAT_24	-	-
-	2508770..2508833	+	64	NuclAT_27	-	-
-	2508770..2508833	+	64	NuclAT_27	-	-
-	2508770..2508833	+	64	NuclAT_27	-	-
-	2508770..2508833	+	64	NuclAT_27	-	-
-	2508770..2508833	+	64	NuclAT_30	-	-
-	2508770..2508833	+	64	NuclAT_30	-	-
-	2508770..2508833	+	64	NuclAT_30	-	-
-	2508770..2508833	+	64	NuclAT_30	-	-
-	2508770..2508835	+	66	NuclAT_15	-	-
-	2508770..2508835	+	66	NuclAT_15	-	-
-	2508770..2508835	+	66	NuclAT_15	-	-
-	2508770..2508835	+	66	NuclAT_15	-	-
-	2508770..2508835	+	66	NuclAT_18	-	-
-	2508770..2508835	+	66	NuclAT_18	-	-
-	2508770..2508835	+	66	NuclAT_18	-	-
-	2508770..2508835	+	66	NuclAT_18	-	-
HVY91_RS12195	2509097..2509204	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2509253..2509316	+	64	NuclAT_20	-	-
-	2509253..2509316	+	64	NuclAT_20	-	-
-	2509253..2509316	+	64	NuclAT_20	-	-
-	2509253..2509316	+	64	NuclAT_20	-	-
-	2509253..2509316	+	64	NuclAT_23	-	-
-	2509253..2509316	+	64	NuclAT_23	-	-
-	2509253..2509316	+	64	NuclAT_23	-	-
-	2509253..2509316	+	64	NuclAT_23	-	-
-	2509253..2509316	+	64	NuclAT_26	-	-
-	2509253..2509316	+	64	NuclAT_26	-	-
-	2509253..2509316	+	64	NuclAT_26	-	-
-	2509253..2509316	+	64	NuclAT_26	-	-
-	2509253..2509316	+	64	NuclAT_29	-	-
-	2509253..2509316	+	64	NuclAT_29	-	-
-	2509253..2509316	+	64	NuclAT_29	-	-
-	2509253..2509316	+	64	NuclAT_29	-	-
-	2509253..2509318	+	66	NuclAT_14	-	-
-	2509253..2509318	+	66	NuclAT_14	-	-
-	2509253..2509318	+	66	NuclAT_14	-	-
-	2509253..2509318	+	66	NuclAT_14	-	-
-	2509253..2509318	+	66	NuclAT_17	-	-
-	2509253..2509318	+	66	NuclAT_17	-	-
-	2509253..2509318	+	66	NuclAT_17	-	-
-	2509253..2509318	+	66	NuclAT_17	-	-
HVY91_RS12200	2509640..2510836	+	1197	WP_001016304.1	methionine gamma-lyase	-
HVY91_RS12205	2511086..2512384	+	1299	WP_181667967.1	amino acid permease	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3867.67 Da
• Isoelectric Point: 9.0157

>T165122 WP_114091462.1 NZ_CP057256:c2507756-2507649 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVITGILASLIVSWLNKRK

Nucleotide

• Length: 108 bp

>T165122 NZ_CP073715:3376973-3377191 [Salmonella enterica subsp. enterica serovar Bovismorbificans]
ATGTCTGATAAACCATTAACTAAAACTGATTATTTGATGCGTTTACGGCGCTGTCAGACAATTGACACTCTGGAGCGCGT
CATTGAGAAAAATAAATATGAATTGTCCGACAATGAGCTGGCTGTATTTTACTCAGCTGCGGATCACCGTCTTGCAGAAT
TGACGATGAACAAACTCTACGACAAGATCCCCTCTTCAGTATGGAAATTCATTCGTTAA

Antitoxin

Nucleotide

• Length: 55 bp

>AT165122 NZ_CP057256:2507814-2507868 [Escherichia fergusonii]
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Antitoxin