Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2064984..2065209 | Replicon | chromosome |
| Accession | NZ_CP057243 | ||
| Organism | Escherichia fergusonii strain RHB32-C05 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | HVY96_RS09885 | Protein ID | WP_061353447.1 |
| Coordinates | 2064997..2065209 (+) | Length | 71 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2064984..2065042 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HVY96_RS09840 | 2060115..2061224 | + | 1110 | WP_072291759.1 | DNA-binding protein | - |
| HVY96_RS09845 | 2061270..2062064 | + | 795 | WP_061353445.1 | DUF1627 domain-containing protein | - |
| HVY96_RS09850 | 2062080..2062484 | + | 405 | WP_040073350.1 | DUF977 family protein | - |
| HVY96_RS09855 | 2062509..2062811 | + | 303 | WP_021522699.1 | hypothetical protein | - |
| HVY96_RS09860 | 2062813..2063169 | + | 357 | WP_000403785.1 | hypothetical protein | - |
| HVY96_RS09865 | 2063265..2063672 | + | 408 | WP_061353446.1 | hypothetical protein | - |
| HVY96_RS09870 | 2063674..2063892 | + | 219 | WP_040073347.1 | DUF4014 family protein | - |
| HVY96_RS09875 | 2063894..2064259 | + | 366 | WP_001229296.1 | HNH endonuclease | - |
| HVY96_RS09880 | 2064256..2064600 | + | 345 | WP_040073345.1 | hypothetical protein | - |
| - | 2064984..2065042 | - | 59 | - | - | Antitoxin |
| HVY96_RS09885 | 2064997..2065209 | + | 213 | WP_061353447.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| HVY96_RS09890 | 2065462..2065629 | + | 168 | WP_163426341.1 | hypothetical protein | - |
| HVY96_RS09895 | 2065696..2065968 | + | 273 | WP_061353448.1 | hypothetical protein | - |
| HVY96_RS09900 | 2065970..2067028 | + | 1059 | WP_061353449.1 | DUF968 domain-containing protein | - |
| HVY96_RS09905 | 2067029..2067406 | + | 378 | WP_032215179.1 | RusA family crossover junction endodeoxyribonuclease | - |
| HVY96_RS09910 | 2067399..2067782 | + | 384 | WP_001345623.1 | antitermination protein | - |
| HVY96_RS09915 | 2068056..2068541 | + | 486 | Protein_1928 | ORF6N domain-containing protein | - |
| HVY96_RS09920 | 2068767..2069510 | + | 744 | WP_001345622.1 | AraC family transcriptional regulator | - |
| HVY96_RS09925 | 2069690..2070082 | + | 393 | WP_001294582.1 | holin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2047007..2150009 | 103002 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 71 a.a. Molecular weight: 7949.53 Da Isoelectric Point: 10.0620
>T165080 WP_061353447.1 NZ_CP057243:2064997-2065209 [Escherichia fergusonii]
MLHKRRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYESEE
MLHKRRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYESEE
Download Length: 213 bp
>T165080 NZ_CP057243:2064997-2065209 [Escherichia fergusonii]
ATGCTACACAAACGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTACGAATCC
GAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAATCTGAGGAGTAA
ATGCTACACAAACGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTACGAATCC
GAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAATCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT165080 NZ_CP057243:c2065042-2064984 [Escherichia fergusonii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTTTGTGTAGCATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTTTGTGTAGCATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|