Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2781236..2781461 | Replicon | chromosome |
Accession | NZ_CP057215 | ||
Organism | Escherichia fergusonii strain RHB33-C04 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | HVZ08_RS13445 | Protein ID | WP_000813254.1 |
Coordinates | 2781236..2781391 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2781403..2781461 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HVZ08_RS13390 | 2776819..2777037 | - | 219 | WP_181666550.1 | class II holin family protein | - |
HVZ08_RS13415 | 2777834..2778523 | - | 690 | WP_096215950.1 | antiterminator | - |
HVZ08_RS13420 | 2778520..2778885 | - | 366 | WP_000139994.1 | RusA family crossover junction endodeoxyribonuclease | - |
HVZ08_RS13425 | 2778886..2779941 | - | 1056 | WP_181666551.1 | DUF968 domain-containing protein | - |
HVZ08_RS13430 | 2779943..2780221 | - | 279 | WP_097419052.1 | hypothetical protein | - |
HVZ08_RS13435 | 2780337..2780822 | - | 486 | WP_000818167.1 | type II toxin-antitoxin system death-on-curing family toxin | - |
HVZ08_RS13440 | 2780841..2781020 | - | 180 | WP_001277774.1 | hypothetical protein | - |
HVZ08_RS13445 | 2781236..2781391 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2781403..2781461 | + | 59 | - | - | Antitoxin |
HVZ08_RS13450 | 2781968..2782876 | + | 909 | WP_001297700.1 | bacteriophage abortive infection AbiH family protein | - |
HVZ08_RS13455 | 2782966..2784357 | + | 1392 | WP_181666552.1 | hypothetical protein | - |
HVZ08_RS13460 | 2784620..2785042 | - | 423 | WP_162522223.1 | DUF977 family protein | - |
HVZ08_RS13465 | 2785083..2786153 | - | 1071 | WP_001262357.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2751624..2797256 | 45632 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T164950 WP_000813254.1 NZ_CP057215:c2781391-2781236 [Escherichia fergusonii]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T164950 NZ_CP073621:c1785353-1785180 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 59 bp
>AT164950 NZ_CP057215:2781403-2781461 [Escherichia fergusonii]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|