Detailed information of TA system TA164740

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokA/Ldr(toxin)
• Location: 4450351..4450570
• Replicon: chromosome
• Accession: NZ_CP057093
• Organism: Escherichia fergusonii strain RHB38-C07

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: -
• Locus tag: HVZ69_RS21655
• Protein ID: WP_181588055.1
• Coordinates: 4450351..4450458 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokA
Locus tag	-
Coordinates	4450507..4450570 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HVZ69_RS21630	4445883..4446071	-	189	WP_001063310.1	YhjR family protein	-
HVZ69_RS21635	4446358..4447917	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HVZ69_RS21640	4447914..4448105	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
HVZ69_RS21645	4448102..4449781	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HVZ69_RS21650	4449868..4449975	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4450033..4450087	+	55	NuclAT_16	-	-
-	4450033..4450087	+	55	NuclAT_16	-	-
-	4450033..4450087	+	55	NuclAT_16	-	-
-	4450033..4450087	+	55	NuclAT_16	-	-
-	4450033..4450087	+	55	NuclAT_19	-	-
-	4450033..4450087	+	55	NuclAT_19	-	-
-	4450033..4450087	+	55	NuclAT_19	-	-
-	4450033..4450087	+	55	NuclAT_19	-	-
-	4450033..4450087	+	55	NuclAT_22	-	-
-	4450033..4450087	+	55	NuclAT_22	-	-
-	4450033..4450087	+	55	NuclAT_22	-	-
-	4450033..4450087	+	55	NuclAT_22	-	-
-	4450033..4450087	+	55	NuclAT_25	-	-
-	4450033..4450087	+	55	NuclAT_25	-	-
-	4450033..4450087	+	55	NuclAT_25	-	-
-	4450033..4450087	+	55	NuclAT_25	-	-
-	4450033..4450089	+	57	NuclAT_10	-	-
-	4450033..4450089	+	57	NuclAT_10	-	-
-	4450033..4450089	+	57	NuclAT_10	-	-
-	4450033..4450089	+	57	NuclAT_10	-	-
-	4450033..4450089	+	57	NuclAT_13	-	-
-	4450033..4450089	+	57	NuclAT_13	-	-
-	4450033..4450089	+	57	NuclAT_13	-	-
-	4450033..4450089	+	57	NuclAT_13	-	-
HVZ69_RS21655	4450351..4450458	-	108	WP_181588055.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4450507..4450570	+	64	NuclAT_15	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_15	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_15	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_15	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_18	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_18	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_18	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_18	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_21	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_21	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_21	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_21	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_24	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_24	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_24	-	Antitoxin
-	4450507..4450570	+	64	NuclAT_24	-	Antitoxin
-	4450507..4450572	+	66	NuclAT_12	-	-
-	4450507..4450572	+	66	NuclAT_12	-	-
-	4450507..4450572	+	66	NuclAT_12	-	-
-	4450507..4450572	+	66	NuclAT_12	-	-
-	4450507..4450572	+	66	NuclAT_9	-	-
-	4450507..4450572	+	66	NuclAT_9	-	-
-	4450507..4450572	+	66	NuclAT_9	-	-
-	4450507..4450572	+	66	NuclAT_9	-	-
HVZ69_RS21660	4450823..4450930	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4450979..4451042	+	64	NuclAT_14	-	-
-	4450979..4451042	+	64	NuclAT_14	-	-
-	4450979..4451042	+	64	NuclAT_14	-	-
-	4450979..4451042	+	64	NuclAT_14	-	-
-	4450979..4451042	+	64	NuclAT_17	-	-
-	4450979..4451042	+	64	NuclAT_17	-	-
-	4450979..4451042	+	64	NuclAT_17	-	-
-	4450979..4451042	+	64	NuclAT_17	-	-
-	4450979..4451042	+	64	NuclAT_20	-	-
-	4450979..4451042	+	64	NuclAT_20	-	-
-	4450979..4451042	+	64	NuclAT_20	-	-
-	4450979..4451042	+	64	NuclAT_20	-	-
-	4450979..4451042	+	64	NuclAT_23	-	-
-	4450979..4451042	+	64	NuclAT_23	-	-
-	4450979..4451042	+	64	NuclAT_23	-	-
-	4450979..4451042	+	64	NuclAT_23	-	-
-	4450979..4451044	+	66	NuclAT_11	-	-
-	4450979..4451044	+	66	NuclAT_11	-	-
-	4450979..4451044	+	66	NuclAT_11	-	-
-	4450979..4451044	+	66	NuclAT_11	-	-
-	4450979..4451044	+	66	NuclAT_8	-	-
-	4450979..4451044	+	66	NuclAT_8	-	-
-	4450979..4451044	+	66	NuclAT_8	-	-
-	4450979..4451044	+	66	NuclAT_8	-	-
HVZ69_RS21665	4451367..4452563	+	1197	WP_181588056.1	methionine gamma-lyase	-
HVZ69_RS21670	4452812..4454110	+	1299	WP_181588057.1	amino acid permease	-
HVZ69_RS21675	4454126..4455337	-	1212	WP_181588058.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3963.80 Da
• Isoelectric Point: 10.7687

>T164740 WP_181588055.1 NZ_CP057093:c4450458-4450351 [Escherichia fergusonii]
MTLAELRMAFWHDLAAPVIAGILASLIVNWLNKRK

Nucleotide

• Length: 108 bp

>T164740 NZ_CP073238:257178-257471 [Pasteurella multocida]
ATGAGTAAGAAAAAAATAAAATTAAAACTGTTTGATATTGCTGAACATCTAGACAGTGAAGAAATGATTGCGGCATATTT
AAGTGAAGTTTTAGAAACATGTGATACTAATGAATTTATTTCCGCTTTAAGTGATGTTGTAAGAGCAAAAGGAATGACGG
AGTTAGCAGCAAAAACAGGGTTAAGAAGAGAAAGCCTCTATAAAACATTATCATACGGTAGCAAGCCACGTTTTGATACG
ATAATGAAAATTATGCATTCCTTAGGTATTAAACTTGTCCCAACGCACATCTAA

Antitoxin

Nucleotide

• Length: 64 bp

>AT164740 NZ_CP057093:4450507-4450570 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Antitoxin