Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-sokX/Ldr(toxin) |
Location | 4449868..4450087 | Replicon | chromosome |
Accession | NZ_CP057093 | ||
Organism | Escherichia fergusonii strain RHB38-C07 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | HVZ69_RS21650 | Protein ID | WP_001295224.1 |
Coordinates | 4449868..4449975 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | sokX | ||
Locus tag | - | ||
Coordinates | 4450033..4450087 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HVZ69_RS21625 | 4445104..4445871 | - | 768 | WP_046082447.1 | cellulose biosynthesis protein BcsQ | - |
HVZ69_RS21630 | 4445883..4446071 | - | 189 | WP_001063310.1 | YhjR family protein | - |
HVZ69_RS21635 | 4446358..4447917 | + | 1560 | WP_001070267.1 | cellulose biosynthesis protein BcsE | - |
HVZ69_RS21640 | 4447914..4448105 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
HVZ69_RS21645 | 4448102..4449781 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
HVZ69_RS21650 | 4449868..4449975 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 4450033..4450087 | + | 55 | NuclAT_16 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_16 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_16 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_16 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_19 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_19 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_19 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_19 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_22 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_22 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_22 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_22 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_25 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_25 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_25 | - | Antitoxin |
- | 4450033..4450087 | + | 55 | NuclAT_25 | - | Antitoxin |
- | 4450033..4450089 | + | 57 | NuclAT_10 | - | - |
- | 4450033..4450089 | + | 57 | NuclAT_10 | - | - |
- | 4450033..4450089 | + | 57 | NuclAT_10 | - | - |
- | 4450033..4450089 | + | 57 | NuclAT_10 | - | - |
- | 4450033..4450089 | + | 57 | NuclAT_13 | - | - |
- | 4450033..4450089 | + | 57 | NuclAT_13 | - | - |
- | 4450033..4450089 | + | 57 | NuclAT_13 | - | - |
- | 4450033..4450089 | + | 57 | NuclAT_13 | - | - |
HVZ69_RS21655 | 4450351..4450458 | - | 108 | WP_181588055.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 4450507..4450570 | + | 64 | NuclAT_15 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_15 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_15 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_15 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_18 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_18 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_18 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_18 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_21 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_21 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_21 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_21 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_24 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_24 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_24 | - | - |
- | 4450507..4450570 | + | 64 | NuclAT_24 | - | - |
- | 4450507..4450572 | + | 66 | NuclAT_12 | - | - |
- | 4450507..4450572 | + | 66 | NuclAT_12 | - | - |
- | 4450507..4450572 | + | 66 | NuclAT_12 | - | - |
- | 4450507..4450572 | + | 66 | NuclAT_12 | - | - |
- | 4450507..4450572 | + | 66 | NuclAT_9 | - | - |
- | 4450507..4450572 | + | 66 | NuclAT_9 | - | - |
- | 4450507..4450572 | + | 66 | NuclAT_9 | - | - |
- | 4450507..4450572 | + | 66 | NuclAT_9 | - | - |
HVZ69_RS21660 | 4450823..4450930 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 4450979..4451042 | + | 64 | NuclAT_14 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_14 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_14 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_14 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_17 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_17 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_17 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_17 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_20 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_20 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_20 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_20 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_23 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_23 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_23 | - | - |
- | 4450979..4451042 | + | 64 | NuclAT_23 | - | - |
- | 4450979..4451044 | + | 66 | NuclAT_11 | - | - |
- | 4450979..4451044 | + | 66 | NuclAT_11 | - | - |
- | 4450979..4451044 | + | 66 | NuclAT_11 | - | - |
- | 4450979..4451044 | + | 66 | NuclAT_11 | - | - |
- | 4450979..4451044 | + | 66 | NuclAT_8 | - | - |
- | 4450979..4451044 | + | 66 | NuclAT_8 | - | - |
- | 4450979..4451044 | + | 66 | NuclAT_8 | - | - |
- | 4450979..4451044 | + | 66 | NuclAT_8 | - | - |
HVZ69_RS21665 | 4451367..4452563 | + | 1197 | WP_181588056.1 | methionine gamma-lyase | - |
HVZ69_RS21670 | 4452812..4454110 | + | 1299 | WP_181588057.1 | amino acid permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T164736 WP_001295224.1 NZ_CP057093:c4449975-4449868 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T164736 NZ_CP073236:c5363214-5362996 [Klebsiella pasteurii]
ATGTCTGATAAAACATTAACCAAAATAGACTATTTGATGCGCTTACGACGCTGTCAGACAATTGATACGCTGGAGCGCGT
AATTGAAAAAAATAAATATGAACTTTCCGATAATGAACTGGCGGTATTTTACTCAGCGGCCGACCATCGTCTTGCTGAGC
TGACGATGAATAAACTGTATGACAAGATCCCACCTTCAGTCTGGAAATTTATCCGCTAG
ATGTCTGATAAAACATTAACCAAAATAGACTATTTGATGCGCTTACGACGCTGTCAGACAATTGATACGCTGGAGCGCGT
AATTGAAAAAAATAAATATGAACTTTCCGATAATGAACTGGCGGTATTTTACTCAGCGGCCGACCATCGTCTTGCTGAGC
TGACGATGAATAAACTGTATGACAAGATCCCACCTTCAGTCTGGAAATTTATCCGCTAG
Antitoxin
Download Length: 55 bp
>AT164736 NZ_CP057093:4450033-4450087 [Escherichia fergusonii]
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|