Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4995563..4995784 Replicon chromosome
Accession NZ_CP056114
Organism Escherichia coli strain Ec394-330266

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag HWD38_RS24295 Protein ID WP_001531632.1
Coordinates 4995563..4995670 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4995718..4995784 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HWD38_RS24270 (4991407) 4991407..4992489 + 1083 WP_000804726.1 peptide chain release factor 1 -
HWD38_RS24275 (4992489) 4992489..4993322 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
HWD38_RS24280 (4993319) 4993319..4993711 + 393 WP_000200375.1 invasion regulator SirB2 -
HWD38_RS24285 (4993715) 4993715..4994524 + 810 WP_001257044.1 invasion regulator SirB1 -
HWD38_RS24290 (4994560) 4994560..4995414 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HWD38_RS24295 (4995563) 4995563..4995670 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4995720) 4995720..4995783 + 64 NuclAT_12 - -
- (4995720) 4995720..4995783 + 64 NuclAT_12 - -
- (4995720) 4995720..4995783 + 64 NuclAT_12 - -
- (4995720) 4995720..4995783 + 64 NuclAT_12 - -
- (4995720) 4995720..4995783 + 64 NuclAT_13 - -
- (4995720) 4995720..4995783 + 64 NuclAT_13 - -
- (4995720) 4995720..4995783 + 64 NuclAT_13 - -
- (4995720) 4995720..4995783 + 64 NuclAT_13 - -
- (4995720) 4995720..4995783 + 64 NuclAT_14 - -
- (4995720) 4995720..4995783 + 64 NuclAT_14 - -
- (4995720) 4995720..4995783 + 64 NuclAT_14 - -
- (4995720) 4995720..4995783 + 64 NuclAT_14 - -
- (4995720) 4995720..4995783 + 64 NuclAT_15 - -
- (4995720) 4995720..4995783 + 64 NuclAT_15 - -
- (4995720) 4995720..4995783 + 64 NuclAT_15 - -
- (4995720) 4995720..4995783 + 64 NuclAT_15 - -
- (4995720) 4995720..4995783 + 64 NuclAT_16 - -
- (4995720) 4995720..4995783 + 64 NuclAT_16 - -
- (4995720) 4995720..4995783 + 64 NuclAT_16 - -
- (4995720) 4995720..4995783 + 64 NuclAT_16 - -
- (4995720) 4995720..4995783 + 64 NuclAT_17 - -
- (4995720) 4995720..4995783 + 64 NuclAT_17 - -
- (4995720) 4995720..4995783 + 64 NuclAT_17 - -
- (4995720) 4995720..4995783 + 64 NuclAT_17 - -
- (4995718) 4995718..4995784 + 67 NuclAT_10 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_10 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_10 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_10 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_5 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_5 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_5 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_5 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_6 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_6 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_6 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_6 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_7 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_7 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_7 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_7 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_8 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_8 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_8 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_8 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_9 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_9 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_9 - Antitoxin
- (4995718) 4995718..4995784 + 67 NuclAT_9 - Antitoxin
- (4995720) 4995720..4995785 + 66 NuclAT_18 - -
- (4995720) 4995720..4995785 + 66 NuclAT_18 - -
- (4995720) 4995720..4995785 + 66 NuclAT_18 - -
- (4995720) 4995720..4995785 + 66 NuclAT_18 - -
- (4995720) 4995720..4995785 + 66 NuclAT_19 - -
- (4995720) 4995720..4995785 + 66 NuclAT_19 - -
- (4995720) 4995720..4995785 + 66 NuclAT_19 - -
- (4995720) 4995720..4995785 + 66 NuclAT_19 - -
- (4995720) 4995720..4995785 + 66 NuclAT_20 - -
- (4995720) 4995720..4995785 + 66 NuclAT_20 - -
- (4995720) 4995720..4995785 + 66 NuclAT_20 - -
- (4995720) 4995720..4995785 + 66 NuclAT_20 - -
- (4995720) 4995720..4995785 + 66 NuclAT_21 - -
- (4995720) 4995720..4995785 + 66 NuclAT_21 - -
- (4995720) 4995720..4995785 + 66 NuclAT_21 - -
- (4995720) 4995720..4995785 + 66 NuclAT_21 - -
- (4995720) 4995720..4995785 + 66 NuclAT_22 - -
- (4995720) 4995720..4995785 + 66 NuclAT_22 - -
- (4995720) 4995720..4995785 + 66 NuclAT_22 - -
- (4995720) 4995720..4995785 + 66 NuclAT_22 - -
- (4995720) 4995720..4995785 + 66 NuclAT_23 - -
- (4995720) 4995720..4995785 + 66 NuclAT_23 - -
- (4995720) 4995720..4995785 + 66 NuclAT_23 - -
- (4995720) 4995720..4995785 + 66 NuclAT_23 - -
HWD38_RS24300 (4996075) 4996075..4997175 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
HWD38_RS24305 (4997445) 4997445..4997684 + 240 WP_000120702.1 putative cation transport regulator ChaB -
HWD38_RS24310 (4997833) 4997833..4998528 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
HWD38_RS24315 (4998572) 4998572..4998925 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
HWD38_RS24320 (4999110) 4999110..5000504 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T162643 WP_001531632.1 NZ_CP056114:c4995670-4995563 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T162643 NZ_CP071916:918562-918816 [Streptococcus pneumoniae]
TTGTATAAATTAGTTCCAACAAGACGTTTCATCAAGCAATTGAAAAAATTGGACCGTTATACGCAGAAGCTAATTACAAA
CTATTTACAAATCAATGTTTTGGAAGACCCAAGACGACACGGAAAGGCTTTGGTTGGTAATCGCGTTGGTCAATGGCGCT
ATAGAATTGGTAATTATCGAGTTATCGTACAAATTGTAGATGATGAATTAGTTGTTGCTACTCTAGAAGTTGGTCATCGG
AGAGATATTTATTGA

Antitoxin


Download         Length: 67 bp

>AT162643 NZ_CP056114:4995718-4995784 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References