Detailed information of TA system TA162476

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokX/Ldr(toxin)
• Location: 4432049..4432268
• Replicon: chromosome
• Accession: NZ_CP055675
• Organism: Escherichia fergusonii strain RHB28-C13

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: -
• Locus tag: HVY52_RS21465
• Protein ID: WP_181202942.1
• Coordinates: 4432049..4432156 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokX
Locus tag	-
Coordinates	4432205..4432268 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HVY52_RS21435	4427099..4427287	-	189	WP_001063310.1	YhjR family protein	-
HVY52_RS21440	4427574..4429133	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HVY52_RS21445	4429130..4429321	+	192	WP_181202941.1	cellulose biosynthesis protein BcsF	-
HVY52_RS21450	4429318..4430997	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HVY52_RS21455	4431084..4431191	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4431249..4431303	+	55	NuclAT_21	-	-
-	4431249..4431303	+	55	NuclAT_21	-	-
-	4431249..4431303	+	55	NuclAT_21	-	-
-	4431249..4431303	+	55	NuclAT_21	-	-
-	4431249..4431303	+	55	NuclAT_24	-	-
-	4431249..4431303	+	55	NuclAT_24	-	-
-	4431249..4431303	+	55	NuclAT_24	-	-
-	4431249..4431303	+	55	NuclAT_24	-	-
-	4431249..4431303	+	55	NuclAT_27	-	-
-	4431249..4431303	+	55	NuclAT_27	-	-
-	4431249..4431303	+	55	NuclAT_27	-	-
-	4431249..4431303	+	55	NuclAT_27	-	-
-	4431249..4431303	+	55	NuclAT_30	-	-
-	4431249..4431303	+	55	NuclAT_30	-	-
-	4431249..4431303	+	55	NuclAT_30	-	-
-	4431249..4431303	+	55	NuclAT_30	-	-
-	4431249..4431305	+	57	NuclAT_15	-	-
-	4431249..4431305	+	57	NuclAT_15	-	-
-	4431249..4431305	+	57	NuclAT_15	-	-
-	4431249..4431305	+	57	NuclAT_15	-	-
-	4431249..4431305	+	57	NuclAT_18	-	-
-	4431249..4431305	+	57	NuclAT_18	-	-
-	4431249..4431305	+	57	NuclAT_18	-	-
-	4431249..4431305	+	57	NuclAT_18	-	-
HVY52_RS21460	4431567..4431674	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4431723..4431786	+	64	NuclAT_20	-	-
-	4431723..4431786	+	64	NuclAT_20	-	-
-	4431723..4431786	+	64	NuclAT_20	-	-
-	4431723..4431786	+	64	NuclAT_20	-	-
-	4431723..4431786	+	64	NuclAT_23	-	-
-	4431723..4431786	+	64	NuclAT_23	-	-
-	4431723..4431786	+	64	NuclAT_23	-	-
-	4431723..4431786	+	64	NuclAT_23	-	-
-	4431723..4431786	+	64	NuclAT_26	-	-
-	4431723..4431786	+	64	NuclAT_26	-	-
-	4431723..4431786	+	64	NuclAT_26	-	-
-	4431723..4431786	+	64	NuclAT_26	-	-
-	4431723..4431786	+	64	NuclAT_29	-	-
-	4431723..4431786	+	64	NuclAT_29	-	-
-	4431723..4431786	+	64	NuclAT_29	-	-
-	4431723..4431786	+	64	NuclAT_29	-	-
-	4431723..4431788	+	66	NuclAT_14	-	-
-	4431723..4431788	+	66	NuclAT_14	-	-
-	4431723..4431788	+	66	NuclAT_14	-	-
-	4431723..4431788	+	66	NuclAT_14	-	-
-	4431723..4431788	+	66	NuclAT_17	-	-
-	4431723..4431788	+	66	NuclAT_17	-	-
-	4431723..4431788	+	66	NuclAT_17	-	-
-	4431723..4431788	+	66	NuclAT_17	-	-
HVY52_RS21465	4432049..4432156	-	108	WP_181202942.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4432205..4432268	+	64	NuclAT_19	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_19	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_19	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_19	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_22	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_22	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_22	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_22	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_25	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_25	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_25	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_25	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_28	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_28	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_28	-	Antitoxin
-	4432205..4432268	+	64	NuclAT_28	-	Antitoxin
-	4432205..4432270	+	66	NuclAT_13	-	-
-	4432205..4432270	+	66	NuclAT_13	-	-
-	4432205..4432270	+	66	NuclAT_13	-	-
-	4432205..4432270	+	66	NuclAT_13	-	-
-	4432205..4432270	+	66	NuclAT_16	-	-
-	4432205..4432270	+	66	NuclAT_16	-	-
-	4432205..4432270	+	66	NuclAT_16	-	-
-	4432205..4432270	+	66	NuclAT_16	-	-
HVY52_RS21470	4432593..4433789	+	1197	WP_181202943.1	methionine gamma-lyase	-
HVY52_RS21475	4434038..4435336	+	1299	WP_181202944.1	amino acid permease	-
HVY52_RS21480	4435352..4436563	-	1212	WP_181202945.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-34)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3850.60 Da
• Isoelectric Point: 7.0027

>T162476 WP_181202942.1 NZ_CP055675:c4432156-4432049 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRN

Nucleotide

• Length: 108 bp

>T162476 NZ_CP071802:c2072637-2072544 [Yersinia ruckeri]
TAAGCCTGCATGAAATGCCAACTTTTAGCGCACGGCTCTATCCCAAGAGCCATTTCCCTGGACCGAATATAGGATTCGTA
TTCGGTCTTTTTTT

Antitoxin

Nucleotide

• Length: 64 bp

>AT162476 NZ_CP055675:4432205-4432268 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGAATACCTGCAACGTGCGGGGGTTTT

Structures

Antitoxin