Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokW/Ldr(toxin)
Location 4431567..4431786 Replicon chromosome
Accession NZ_CP055675
Organism Escherichia fergusonii strain RHB28-C13

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag HVY52_RS21460 Protein ID WP_000170738.1
Coordinates 4431567..4431674 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 4431723..4431786 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HVY52_RS21435 4427099..4427287 - 189 WP_001063310.1 YhjR family protein -
HVY52_RS21440 4427574..4429133 + 1560 WP_001070267.1 cellulose biosynthesis protein BcsE -
HVY52_RS21445 4429130..4429321 + 192 WP_181202941.1 cellulose biosynthesis protein BcsF -
HVY52_RS21450 4429318..4430997 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
HVY52_RS21455 4431084..4431191 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4431249..4431303 + 55 NuclAT_21 - -
- 4431249..4431303 + 55 NuclAT_21 - -
- 4431249..4431303 + 55 NuclAT_21 - -
- 4431249..4431303 + 55 NuclAT_21 - -
- 4431249..4431303 + 55 NuclAT_24 - -
- 4431249..4431303 + 55 NuclAT_24 - -
- 4431249..4431303 + 55 NuclAT_24 - -
- 4431249..4431303 + 55 NuclAT_24 - -
- 4431249..4431303 + 55 NuclAT_27 - -
- 4431249..4431303 + 55 NuclAT_27 - -
- 4431249..4431303 + 55 NuclAT_27 - -
- 4431249..4431303 + 55 NuclAT_27 - -
- 4431249..4431303 + 55 NuclAT_30 - -
- 4431249..4431303 + 55 NuclAT_30 - -
- 4431249..4431303 + 55 NuclAT_30 - -
- 4431249..4431303 + 55 NuclAT_30 - -
- 4431249..4431305 + 57 NuclAT_15 - -
- 4431249..4431305 + 57 NuclAT_15 - -
- 4431249..4431305 + 57 NuclAT_15 - -
- 4431249..4431305 + 57 NuclAT_15 - -
- 4431249..4431305 + 57 NuclAT_18 - -
- 4431249..4431305 + 57 NuclAT_18 - -
- 4431249..4431305 + 57 NuclAT_18 - -
- 4431249..4431305 + 57 NuclAT_18 - -
HVY52_RS21460 4431567..4431674 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4431723..4431786 + 64 NuclAT_20 - Antitoxin
- 4431723..4431786 + 64 NuclAT_20 - Antitoxin
- 4431723..4431786 + 64 NuclAT_20 - Antitoxin
- 4431723..4431786 + 64 NuclAT_20 - Antitoxin
- 4431723..4431786 + 64 NuclAT_23 - Antitoxin
- 4431723..4431786 + 64 NuclAT_23 - Antitoxin
- 4431723..4431786 + 64 NuclAT_23 - Antitoxin
- 4431723..4431786 + 64 NuclAT_23 - Antitoxin
- 4431723..4431786 + 64 NuclAT_26 - Antitoxin
- 4431723..4431786 + 64 NuclAT_26 - Antitoxin
- 4431723..4431786 + 64 NuclAT_26 - Antitoxin
- 4431723..4431786 + 64 NuclAT_26 - Antitoxin
- 4431723..4431786 + 64 NuclAT_29 - Antitoxin
- 4431723..4431786 + 64 NuclAT_29 - Antitoxin
- 4431723..4431786 + 64 NuclAT_29 - Antitoxin
- 4431723..4431786 + 64 NuclAT_29 - Antitoxin
- 4431723..4431788 + 66 NuclAT_14 - -
- 4431723..4431788 + 66 NuclAT_14 - -
- 4431723..4431788 + 66 NuclAT_14 - -
- 4431723..4431788 + 66 NuclAT_14 - -
- 4431723..4431788 + 66 NuclAT_17 - -
- 4431723..4431788 + 66 NuclAT_17 - -
- 4431723..4431788 + 66 NuclAT_17 - -
- 4431723..4431788 + 66 NuclAT_17 - -
HVY52_RS21465 4432049..4432156 - 108 WP_181202942.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4432205..4432268 + 64 NuclAT_19 - -
- 4432205..4432268 + 64 NuclAT_19 - -
- 4432205..4432268 + 64 NuclAT_19 - -
- 4432205..4432268 + 64 NuclAT_19 - -
- 4432205..4432268 + 64 NuclAT_22 - -
- 4432205..4432268 + 64 NuclAT_22 - -
- 4432205..4432268 + 64 NuclAT_22 - -
- 4432205..4432268 + 64 NuclAT_22 - -
- 4432205..4432268 + 64 NuclAT_25 - -
- 4432205..4432268 + 64 NuclAT_25 - -
- 4432205..4432268 + 64 NuclAT_25 - -
- 4432205..4432268 + 64 NuclAT_25 - -
- 4432205..4432268 + 64 NuclAT_28 - -
- 4432205..4432268 + 64 NuclAT_28 - -
- 4432205..4432268 + 64 NuclAT_28 - -
- 4432205..4432268 + 64 NuclAT_28 - -
- 4432205..4432270 + 66 NuclAT_13 - -
- 4432205..4432270 + 66 NuclAT_13 - -
- 4432205..4432270 + 66 NuclAT_13 - -
- 4432205..4432270 + 66 NuclAT_13 - -
- 4432205..4432270 + 66 NuclAT_16 - -
- 4432205..4432270 + 66 NuclAT_16 - -
- 4432205..4432270 + 66 NuclAT_16 - -
- 4432205..4432270 + 66 NuclAT_16 - -
HVY52_RS21470 4432593..4433789 + 1197 WP_181202943.1 methionine gamma-lyase -
HVY52_RS21475 4434038..4435336 + 1299 WP_181202944.1 amino acid permease -
HVY52_RS21480 4435352..4436563 - 1212 WP_181202945.1 sigma 54-interacting transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T162474 WP_000170738.1 NZ_CP055675:c4431674-4431567 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp

>T162474 NZ_CP071802:1062445-1062765 [Yersinia ruckeri]
ATGCAAACTTTACCCGTATCTCCGACGCGGGAGGCTCAGCTTGGCCCGTCACCCGCAGCTGTCTGGAAACAACTCCTGAC
GCATCTGTTTGAGCACCATTACGGCCTGACGCTCAATGACACTCCCTTCTGCTACGAATTCGTAATACAGGAACATATTG
AATCCGGCATTTTGCTGAAAGATGCCGTGAATTTTGTGGTCGAACGCTATGGCCTTTTACGTATTGATCGCAGTAGTTTC
TCCTTTGATGAGCCGTCACCGTTTATTAATTTTACCGATATTCTTCGAGCCAGACGAGCAATCGGACTGATGAATACTTA
A

Antitoxin


Download         Length: 64 bp

>AT162474 NZ_CP055675:4431723-4431786 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829L523

Antitoxin

Download structure file

References