Detailed information of TA system TA162196

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 69503..69757
• Replicon: plasmid pAH62-3
• Accession: NZ_CP055262
• Organism: Escherichia coli strain AH62

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: HU676_RS24150
• Protein ID: WP_001351576.1
• Coordinates: 69551..69757 (+)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	69503..69564 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HU676_RS24115	64926..65615	+	690	Protein_58	DUF87 domain-containing protein	-
HU676_RS24120	65614..66231	+	618	Protein_59	AAA family ATPase	-
HU676_RS24125	66251..66997	+	747	WP_000205749.1	conjugal transfer pilus acetylase TraX	-
HU676_RS24130	67056..67916	+	861	WP_000704513.1	alpha/beta hydrolase	-
HU676_RS24135	68019..68579	+	561	WP_176256657.1	fertility inhibition protein FinO	-
HU676_RS24140	68715..68927	+	213	WP_001299730.1	ANR family transcriptional regulator	-
HU676_RS24145	69173..69247	+	75	Protein_64	endonuclease	-
-	69503..69564	-	62	NuclAT_1	-	Antitoxin
-	69503..69564	-	62	NuclAT_1	-	Antitoxin
-	69503..69564	-	62	NuclAT_1	-	Antitoxin
-	69503..69564	-	62	NuclAT_1	-	Antitoxin
HU676_RS24150	69551..69757	+	207	WP_001351576.1	type I toxin-antitoxin system Hok family toxin	Toxin
HU676_RS24155	70041..70298	+	258	WP_000083845.1	replication regulatory protein RepA	-
HU676_RS24160	70530..70604	+	75	WP_001442103.1	RepA leader peptide Tap	-
HU676_RS24165	70597..71079	+	483	WP_001273588.1	hypothetical protein	-
HU676_RS24170	71072..71929	+	858	WP_000774297.1	incFII family plasmid replication initiator RepA	-
HU676_RS24175	72631..72771	+	141	WP_001333237.1	hypothetical protein	-
HU676_RS24180	72869..73522	+	654	WP_000616807.1	CPBP family intramembrane metalloprotease	-
HU676_RS24185	73615..73872	+	258	WP_000557619.1	type II toxin-antitoxin system antitoxin PemI	-
HU676_RS24190	73805..74206	+	402	WP_001398199.1	type II toxin-antitoxin system toxin endoribonuclease PemK	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	sitABCD / blaTEM-1A / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / aac(3)-IId / aadA5 / qacE / sul1 / mph(A)	iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA	1..136694	136694
	-	flank	IS/Tn	-	-	64153..64809	656

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7826.31 Da
• Isoelectric Point: 8.8807

>T162196 WP_001351576.1 NZ_CP055262:69551-69757 [Escherichia coli]
MKYLNTTDCSLFFAERSKFMTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

>T162196 NZ_CP071686:c2693343-2693240 [Salmonella sp. SAL-007]
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT

Antitoxin

Nucleotide

• Length: 62 bp

>AT162196 NZ_CP055262:c69564-69503 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin