Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 120402..120828 | Replicon | plasmid pAH01-4 |
Accession | NZ_CP055255 | ||
Organism | Escherichia coli strain AH01 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | HUU83_RS25360 | Protein ID | WP_001312861.1 |
Coordinates | 120402..120560 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 120604..120828 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUU83_RS25335 | 115776..116465 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
HUU83_RS25340 | 116652..117035 | - | 384 | WP_001151524.1 | relaxosome protein TraM | - |
HUU83_RS25345 | 117356..117958 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
HUU83_RS25350 | 118255..119076 | - | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
HUU83_RS25355 | 119194..119481 | - | 288 | WP_063121090.1 | hypothetical protein | - |
HUU83_RS25360 | 120402..120560 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 120604..120828 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 120604..120828 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 120604..120828 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 120604..120828 | - | 225 | NuclAT_0 | - | Antitoxin |
HUU83_RS25365 | 120640..120828 | + | 189 | WP_001299721.1 | hypothetical protein | - |
HUU83_RS25370 | 120840..121559 | - | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
HUU83_RS25375 | 121556..121990 | - | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
HUU83_RS25380 | 122045..122242 | - | 198 | Protein_136 | hypothetical protein | - |
HUU83_RS25385 | 122270..122503 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
HUU83_RS25390 | 122571..123110 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
HUU83_RS25395 | 123136..123342 | - | 207 | WP_000275856.1 | hypothetical protein | - |
HUU83_RS25400 | 124438..125409 | - | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / sul1 / qacE / ARR-3 / catB3 / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IVa / aph(4)-Ia / sul2 / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..145790 | 145790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T162129 WP_001312861.1 NZ_CP055255:c120560-120402 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T162129 NZ_CP071594:c470295-470188 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 225 bp
>AT162129 NZ_CP055255:c120828-120604 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|