Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 30045..30314 | Replicon | plasmid pAH01-3 |
Accession | NZ_CP055254 | ||
Organism | Escherichia coli strain AH01 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | HUU83_RS24450 | Protein ID | WP_001312861.1 |
Coordinates | 30156..30314 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 30045..30110 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUU83_RS24420 | 25755..26282 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
HUU83_RS24425 | 26340..26573 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
HUU83_RS24430 | 26634..28657 | + | 2024 | Protein_39 | ParB/RepB/Spo0J family partition protein | - |
HUU83_RS24435 | 28726..29160 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
HUU83_RS24440 | 29157..29876 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 29888..30112 | + | 225 | NuclAT_0 | - | - |
- | 29888..30112 | + | 225 | NuclAT_0 | - | - |
- | 29888..30112 | + | 225 | NuclAT_0 | - | - |
- | 29888..30112 | + | 225 | NuclAT_0 | - | - |
HUU83_RS24445 | 29897..30076 | - | 180 | WP_001309233.1 | hypothetical protein | - |
- | 30045..30110 | + | 66 | - | - | Antitoxin |
HUU83_RS24450 | 30156..30314 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
HUU83_RS24455 | 30552..30929 | - | 378 | Protein_44 | hypothetical protein | - |
HUU83_RS24460 | 31229..31525 | + | 297 | WP_001272251.1 | hypothetical protein | - |
HUU83_RS24465 | 31636..32457 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
HUU83_RS24470 | 32754..33401 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
HUU83_RS24475 | 33678..34061 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
HUU83_RS24480 | 34252..34710 | + | 459 | Protein_49 | PAS domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | fosA3 / blaTEM-1B / blaCTX-M-55 | - | 1..71937 | 71937 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T162119 WP_001312861.1 NZ_CP055254:30156-30314 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T162119 NZ_CP071589:c1819398-1819243 [Staphylococcus simiae]
ATGGTTAATGAAAAAGATGCTAAATTAAATTATCATGAAGATGAAAATGCAATGGTAAATGATTTTGATGATTTGAAAGA
ACTAGGTAAAGAAATGGAACAAATTTCTGAAGAAAACGATCAAGAAAAGCATAATCAATCACACGATAATAATTAA
ATGGTTAATGAAAAAGATGCTAAATTAAATTATCATGAAGATGAAAATGCAATGGTAAATGATTTTGATGATTTGAAAGA
ACTAGGTAAAGAAATGGAACAAATTTCTGAAGAAAACGATCAAGAAAAGCATAATCAATCACACGATAATAATTAA
Antitoxin
Download Length: 66 bp
>AT162119 NZ_CP055254:30045-30110 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|