Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 88576..88829 | Replicon | plasmid pZY-1 |
Accession | NZ_CP055248 | ||
Organism | Citrobacter freundii strain ZY198 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | GTH18_RS24470 | Protein ID | WP_001312851.1 |
Coordinates | 88680..88829 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 88576..88635 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTH18_RS24445 | 85303..86049 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
GTH18_RS24450 | 86104..86664 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
GTH18_RS24455 | 86796..86996 | + | 201 | WP_015059022.1 | hypothetical protein | - |
GTH18_RS24460 | 87382..87981 | + | 600 | WP_105906770.1 | hypothetical protein | - |
GTH18_RS24465 | 88145..88375 | + | 231 | WP_001736714.1 | hypothetical protein | - |
- | 88576..88635 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 88576..88635 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 88576..88635 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 88576..88635 | - | 60 | NuclAT_1 | - | Antitoxin |
GTH18_RS24470 | 88680..88829 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
GTH18_RS24475 | 89113..89361 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / fosA3 / blaTEM-1B / blaCTX-M-55 | - | 1..89672 | 89672 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T162085 WP_001312851.1 NZ_CP055248:88680-88829 [Citrobacter freundii]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T162085 NZ_CP071522:198454-198561 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT162085 NZ_CP055248:c88635-88576 [Citrobacter freundii]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|