Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 49116..49385 | Replicon | plasmid pZY-1 |
| Accession | NZ_CP055248 | ||
| Organism | Citrobacter freundii strain ZY198 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | GTH18_RS24245 | Protein ID | WP_001312861.1 |
| Coordinates | 49227..49385 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 49116..49181 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GTH18_RS24220 | 44826..45353 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| GTH18_RS24225 | 45411..45644 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| GTH18_RS24230 | 45705..47728 | + | 2024 | Protein_58 | ParB/RepB/Spo0J family partition protein | - |
| GTH18_RS24235 | 47797..48231 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| GTH18_RS24240 | 48228..48947 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 48959..49183 | + | 225 | NuclAT_0 | - | - |
| - | 48959..49183 | + | 225 | NuclAT_0 | - | - |
| - | 48959..49183 | + | 225 | NuclAT_0 | - | - |
| - | 48959..49183 | + | 225 | NuclAT_0 | - | - |
| - | 49116..49181 | + | 66 | - | - | Antitoxin |
| GTH18_RS24245 | 49227..49385 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| GTH18_RS24250 | 50282..50578 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| GTH18_RS24255 | 50689..51510 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| GTH18_RS24260 | 51807..52454 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| GTH18_RS24265 | 52731..53114 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| GTH18_RS24270 | 53305..53991 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| GTH18_RS24275 | 54085..54312 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / fosA3 / blaTEM-1B / blaCTX-M-55 | - | 1..89672 | 89672 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T162082 WP_001312861.1 NZ_CP055248:49227-49385 [Citrobacter freundii]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T162082 NZ_CP071521:c4221902-4221729 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 66 bp
>AT162082 NZ_CP055248:49116-49181 [Citrobacter freundii]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|