Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3185362..3185620 | Replicon | chromosome |
Accession | NZ_CP055227 | ||
Organism | Erwinia amylovora strain Ea1189 |
Toxin (Protein)
Gene name | hok | Uniprot ID | D4I1C1 |
Locus tag | GTU81_RS14545 | Protein ID | WP_004160031.1 |
Coordinates | 3185362..3185520 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 3185574..3185620 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GTU81_RS14530 | 3180667..3182358 | - | 1692 | WP_004160025.1 | chloride channel protein | - |
GTU81_RS14535 | 3182771..3183751 | + | 981 | WP_013035818.1 | TerC family protein | - |
GTU81_RS14540 | 3183986..3185218 | + | 1233 | WP_004160030.1 | serine/threonine transporter SstT | - |
GTU81_RS14545 | 3185362..3185520 | - | 159 | WP_004160031.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 3185574..3185620 | + | 47 | - | - | Antitoxin |
GTU81_RS14550 | 3186331..3187005 | + | 675 | WP_004160034.1 | DedA family protein | - |
GTU81_RS14555 | 3187002..3187394 | + | 393 | WP_004160035.1 | EnvZ/OmpR regulon moderator MzrA | - |
GTU81_RS14560 | 3187562..3187933 | + | 372 | WP_004160036.1 | DUF1090 domain-containing protein | - |
GTU81_RS14565 | 3187976..3188281 | + | 306 | WP_004160037.1 | DUF883 family protein | - |
GTU81_RS14570 | 3188283..3188675 | + | 393 | WP_004160038.1 | phage holin family protein | - |
GTU81_RS14575 | 3188675..3188956 | + | 282 | WP_004160039.1 | YqjK-like family protein | - |
GTU81_RS14580 | 3189166..3189558 | + | 393 | WP_004160048.1 | DoxX family protein | - |
GTU81_RS14585 | 3190031..3190174 | + | 144 | WP_004160049.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6038.32 Da Isoelectric Point: 8.4901
>T162050 WP_004160031.1 NZ_CP055227:c3185520-3185362 [Erwinia amylovora]
MKLPANCLIWCVLIVCVTLLIFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
MKLPANCLIWCVLIVCVTLLIFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
Download Length: 159 bp
>T162050 NZ_CP071505:958291-958440 [Staphylococcus haemolyticus]
ATGACTAAAAATAAAGATTCAGAATTAAATTATCATGAGGAAGAAAATGCGATGGTTCAAGATTTAGATGACTTGAAAAC
ATTGGGCAAAGAAATGGAACAAATTTCTGAAGAAAACGACGAGGACAGGTTGAATCAATCGCATGAGTAA
ATGACTAAAAATAAAGATTCAGAATTAAATTATCATGAGGAAGAAAATGCGATGGTTCAAGATTTAGATGACTTGAAAAC
ATTGGGCAAAGAAATGGAACAAATTTCTGAAGAAAACGACGAGGACAGGTTGAATCAATCGCATGAGTAA
Antitoxin
Download Length: 47 bp
>AT162050 NZ_CP055227:3185574-3185620 [Erwinia amylovora]
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|