Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 62032..62286 | Replicon | plasmid unnamed1 |
Accession | NZ_CP055195 | ||
Organism | Shigella flexneri strain STEFF_10 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | HUZ40_RS23860 | Protein ID | WP_001312851.1 |
Coordinates | 62032..62181 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 62225..62286 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUZ40_RS23815 (57584) | 57584..57985 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
HUZ40_RS23820 (57918) | 57918..58175 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
HUZ40_RS23825 (58268) | 58268..58921 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
HUZ40_RS23830 (59019) | 59019..59159 | - | 141 | WP_001333237.1 | hypothetical protein | - |
HUZ40_RS23835 (59860) | 59860..60717 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
HUZ40_RS23840 (60710) | 60710..61192 | - | 483 | WP_001273588.1 | hypothetical protein | - |
HUZ40_RS23845 (61185) | 61185..61232 | - | 48 | WP_229471593.1 | hypothetical protein | - |
HUZ40_RS23850 (61223) | 61223..61474 | + | 252 | WP_223195197.1 | replication protein RepA | - |
HUZ40_RS23855 (61491) | 61491..61748 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
HUZ40_RS23860 (62032) | 62032..62181 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
- (62225) | 62225..62286 | + | 62 | NuclAT_1 | - | Antitoxin |
- (62225) | 62225..62286 | + | 62 | NuclAT_1 | - | Antitoxin |
- (62225) | 62225..62286 | + | 62 | NuclAT_1 | - | Antitoxin |
- (62225) | 62225..62286 | + | 62 | NuclAT_1 | - | Antitoxin |
HUZ40_RS23865 (62542) | 62542..62616 | - | 75 | Protein_69 | endonuclease | - |
HUZ40_RS23870 (62862) | 62862..63074 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
HUZ40_RS23875 (63210) | 63210..63770 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
HUZ40_RS23880 (63873) | 63873..64733 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
HUZ40_RS23885 (64792) | 64792..65538 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(3')-Ia / catA2 / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..125749 | 125749 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T161879 WP_001312851.1 NZ_CP055195:c62181-62032 [Shigella flexneri]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T161879 NZ_CP071385:3960964-3961182 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACCTCTGTCTGGAAATTTATCCGCTAA
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACCTCTGTCTGGAAATTTATCCGCTAA
Antitoxin
Download Length: 62 bp
>AT161879 NZ_CP055195:62225-62286 [Shigella flexneri]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|