Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1844883..1845103 Replicon chromosome
Accession NZ_CP055170
Organism Shigella flexneri strain STEFF_22

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag HUZ49_RS08835 Protein ID WP_000170954.1
Coordinates 1844883..1844990 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1845040..1845103 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUZ49_RS08810 (1840727) 1840727..1841809 + 1083 WP_000804726.1 peptide chain release factor 1 -
HUZ49_RS08815 (1841809) 1841809..1842642 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
HUZ49_RS08820 (1842639) 1842639..1843031 + 393 WP_000200378.1 invasion regulator SirB2 -
HUZ49_RS08825 (1843035) 1843035..1843844 + 810 WP_001257044.1 invasion regulator SirB1 -
HUZ49_RS08830 (1843880) 1843880..1844734 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HUZ49_RS08835 (1844883) 1844883..1844990 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1845040) 1845040..1845103 + 64 NuclAT_39 - Antitoxin
- (1845040) 1845040..1845103 + 64 NuclAT_39 - Antitoxin
- (1845040) 1845040..1845103 + 64 NuclAT_39 - Antitoxin
- (1845040) 1845040..1845103 + 64 NuclAT_39 - Antitoxin
- (1845040) 1845040..1845103 + 64 NuclAT_42 - Antitoxin
- (1845040) 1845040..1845103 + 64 NuclAT_42 - Antitoxin
- (1845040) 1845040..1845103 + 64 NuclAT_42 - Antitoxin
- (1845040) 1845040..1845103 + 64 NuclAT_42 - Antitoxin
- (1845040) 1845040..1845103 + 64 NuclAT_45 - Antitoxin
- (1845040) 1845040..1845103 + 64 NuclAT_45 - Antitoxin
- (1845040) 1845040..1845103 + 64 NuclAT_45 - Antitoxin
- (1845040) 1845040..1845103 + 64 NuclAT_45 - Antitoxin
HUZ49_RS08840 (1845418) 1845418..1845525 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1845578) 1845578..1845639 + 62 NuclAT_38 - -
- (1845578) 1845578..1845639 + 62 NuclAT_38 - -
- (1845578) 1845578..1845639 + 62 NuclAT_38 - -
- (1845578) 1845578..1845639 + 62 NuclAT_38 - -
- (1845578) 1845578..1845639 + 62 NuclAT_41 - -
- (1845578) 1845578..1845639 + 62 NuclAT_41 - -
- (1845578) 1845578..1845639 + 62 NuclAT_41 - -
- (1845578) 1845578..1845639 + 62 NuclAT_41 - -
- (1845578) 1845578..1845639 + 62 NuclAT_44 - -
- (1845578) 1845578..1845639 + 62 NuclAT_44 - -
- (1845578) 1845578..1845639 + 62 NuclAT_44 - -
- (1845578) 1845578..1845639 + 62 NuclAT_44 - -
- (1845578) 1845578..1845641 + 64 NuclAT_14 - -
- (1845578) 1845578..1845641 + 64 NuclAT_14 - -
- (1845578) 1845578..1845641 + 64 NuclAT_14 - -
- (1845578) 1845578..1845641 + 64 NuclAT_14 - -
- (1845578) 1845578..1845641 + 64 NuclAT_16 - -
- (1845578) 1845578..1845641 + 64 NuclAT_16 - -
- (1845578) 1845578..1845641 + 64 NuclAT_16 - -
- (1845578) 1845578..1845641 + 64 NuclAT_16 - -
- (1845578) 1845578..1845641 + 64 NuclAT_18 - -
- (1845578) 1845578..1845641 + 64 NuclAT_18 - -
- (1845578) 1845578..1845641 + 64 NuclAT_18 - -
- (1845578) 1845578..1845641 + 64 NuclAT_18 - -
- (1845578) 1845578..1845641 + 64 NuclAT_20 - -
- (1845578) 1845578..1845641 + 64 NuclAT_20 - -
- (1845578) 1845578..1845641 + 64 NuclAT_20 - -
- (1845578) 1845578..1845641 + 64 NuclAT_20 - -
- (1845578) 1845578..1845641 + 64 NuclAT_22 - -
- (1845578) 1845578..1845641 + 64 NuclAT_22 - -
- (1845578) 1845578..1845641 + 64 NuclAT_22 - -
- (1845578) 1845578..1845641 + 64 NuclAT_22 - -
- (1845578) 1845578..1845641 + 64 NuclAT_24 - -
- (1845578) 1845578..1845641 + 64 NuclAT_24 - -
- (1845578) 1845578..1845641 + 64 NuclAT_24 - -
- (1845578) 1845578..1845641 + 64 NuclAT_24 - -
HUZ49_RS08845 (1845954) 1845954..1846061 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1846109) 1846109..1846174 + 66 NuclAT_37 - -
- (1846109) 1846109..1846174 + 66 NuclAT_37 - -
- (1846109) 1846109..1846174 + 66 NuclAT_37 - -
- (1846109) 1846109..1846174 + 66 NuclAT_37 - -
- (1846109) 1846109..1846174 + 66 NuclAT_40 - -
- (1846109) 1846109..1846174 + 66 NuclAT_40 - -
- (1846109) 1846109..1846174 + 66 NuclAT_40 - -
- (1846109) 1846109..1846174 + 66 NuclAT_40 - -
- (1846109) 1846109..1846174 + 66 NuclAT_43 - -
- (1846109) 1846109..1846174 + 66 NuclAT_43 - -
- (1846109) 1846109..1846174 + 66 NuclAT_43 - -
- (1846109) 1846109..1846174 + 66 NuclAT_43 - -
- (1846109) 1846109..1846176 + 68 NuclAT_13 - -
- (1846109) 1846109..1846176 + 68 NuclAT_13 - -
- (1846109) 1846109..1846176 + 68 NuclAT_13 - -
- (1846109) 1846109..1846176 + 68 NuclAT_13 - -
- (1846109) 1846109..1846176 + 68 NuclAT_15 - -
- (1846109) 1846109..1846176 + 68 NuclAT_15 - -
- (1846109) 1846109..1846176 + 68 NuclAT_15 - -
- (1846109) 1846109..1846176 + 68 NuclAT_15 - -
- (1846109) 1846109..1846176 + 68 NuclAT_17 - -
- (1846109) 1846109..1846176 + 68 NuclAT_17 - -
- (1846109) 1846109..1846176 + 68 NuclAT_17 - -
- (1846109) 1846109..1846176 + 68 NuclAT_17 - -
- (1846109) 1846109..1846176 + 68 NuclAT_19 - -
- (1846109) 1846109..1846176 + 68 NuclAT_19 - -
- (1846109) 1846109..1846176 + 68 NuclAT_19 - -
- (1846109) 1846109..1846176 + 68 NuclAT_19 - -
- (1846109) 1846109..1846176 + 68 NuclAT_21 - -
- (1846109) 1846109..1846176 + 68 NuclAT_21 - -
- (1846109) 1846109..1846176 + 68 NuclAT_21 - -
- (1846109) 1846109..1846176 + 68 NuclAT_21 - -
- (1846109) 1846109..1846176 + 68 NuclAT_23 - -
- (1846109) 1846109..1846176 + 68 NuclAT_23 - -
- (1846109) 1846109..1846176 + 68 NuclAT_23 - -
- (1846109) 1846109..1846176 + 68 NuclAT_23 - -
HUZ49_RS08850 (1846466) 1846466..1847566 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
HUZ49_RS08855 (1847836) 1847836..1848066 + 231 WP_001146442.1 putative cation transport regulator ChaB -
HUZ49_RS08860 (1848224) 1848224..1848919 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
HUZ49_RS08865 (1848963) 1848963..1849316 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T161708 WP_000170954.1 NZ_CP055170:c1844990-1844883 [Shigella flexneri]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T161708 NZ_CP071259:c704341-703877 [Escherichia coli]
ATGGATTTTCCACAAAGGGTTAATGGTTGGGCGCTATATGCTCATCCCTGTTTTCAGGAAACCTACGACGCTTTAGTTGC
CGAAGTCGAGACATTAAAGGGAAAAGATCCTGAAAATTATCAGAGAAAAGCCGCCACAAAGTTATTGGCGGTAGTCCATA
AAGTGATTGAGGAGCATATCACGGTCAATCCATCATCACCGGCATTCCGTCATGGCAAGTCGTTAGGCTCTGGGAAAAAT
AAAGACTGGTCACGGGTAAAATTTGGTGCTGGTCGTTATCGTCTCTTCTTTCGTTATAGTGAAAAAGAGAAAGTCATCAT
TCTGGGATGGATGAACGATGAAAACACTCTGCGCACCTACGGTAAAAAAACAGATGCCTATACCGTATTCAGCAAAATGT
TAAAAAGAGGACATCCTCCTGCCGACTGGGAAAGCCTCACCCAAGAGACAGAAGAAAACCATTGA

Antitoxin


Download         Length: 64 bp

>AT161708 NZ_CP055170:1845040-1845103 [Shigella flexneri]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTAAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References