Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 143198..143452 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP055071 | ||
| Organism | Shigella flexneri strain SWHIN_97 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | HUZ91_RS24065 | Protein ID | WP_001312851.1 |
| Coordinates | 143303..143452 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 143198..143259 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HUZ91_RS24050 (141151) | 141151..141894 | + | 744 | WP_039002216.1 | conjugal transfer pilus acetylase TraX | - |
| HUZ91_RS24055 (141949) | 141949..142509 | + | 561 | WP_000139310.1 | fertility inhibition protein FinO | - |
| HUZ91_RS24060 (142644) | 142644..142856 | + | 213 | WP_001541896.1 | ANR family transcriptional regulator | - |
| - (143198) | 143198..143259 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (143198) | 143198..143259 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (143198) | 143198..143259 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (143198) | 143198..143259 | - | 62 | NuclAT_1 | - | Antitoxin |
| HUZ91_RS24065 (143303) | 143303..143452 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| HUZ91_RS24070 (143720) | 143720..143977 | + | 258 | WP_001541895.1 | replication regulatory protein RepA | - |
| HUZ91_RS24075 (144080) | 144080..144263 | + | 184 | Protein_161 | plasmid copy control protein CopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | oqxA / oqxB / qnrS1 / sul3 | - | 1..144275 | 144275 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T161367 WP_001312851.1 NZ_CP055071:143303-143452 [Shigella flexneri]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T161367 NZ_CP071138:1180831-1180938 [Mammaliicoccus sciuri]
ATGGTTCAAGATCTAGAAGATGTTAAAGAACTAGGTAAAGAAATGGAACAAATATCAGAACAAAATGATGAGGCTTTTGA
AGAAAAGAAATCTGAACAAGAATCTTAA
ATGGTTCAAGATCTAGAAGATGTTAAAGAACTAGGTAAAGAAATGGAACAAATATCAGAACAAAATGATGAGGCTTTTGA
AGAAAAGAAATCTGAACAAGAATCTTAA
Antitoxin
Download Length: 62 bp
>AT161367 NZ_CP055071:c143259-143198 [Shigella flexneri]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|