Detailed information of TA system TA161038

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 73490..73723
• Replicon: plasmid unnamed1
• Accession: NZ_CP055020
• Organism: Escherichia coli strain SWHEFF_69

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: HUZ77_RS23975
• Protein ID: WP_001372321.1
• Coordinates: 73490..73615 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	73692..73723 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HUZ77_RS23935 (68864)	68864..69553	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
HUZ77_RS23940 (69740)	69740..70123	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
HUZ77_RS23945 (70444)	70444..71046	+	603	WP_013362798.1	transglycosylase SLT domain-containing protein	-
HUZ77_RS23950 (71343)	71343..72164	-	822	WP_001234426.1	DUF932 domain-containing protein	-
HUZ77_RS23955 (72282)	72282..72569	-	288	WP_000107535.1	hypothetical protein	-
HUZ77_RS23960 (72594)	72594..72800	-	207	WP_000547968.1	hypothetical protein	-
HUZ77_RS23965 (72870)	72870..73042	+	173	Protein_92	hypothetical protein	-
HUZ77_RS23970 (73040)	73040..73270	-	231	WP_071886920.1	hypothetical protein	-
HUZ77_RS23975 (73490)	73490..73615	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
HUZ77_RS23980 (73557)	73557..73706	-	150	Protein_95	plasmid maintenance protein Mok	-
- (73692)	73692..73723	-	32	NuclAT_1	-	Antitoxin
- (73692)	73692..73723	-	32	NuclAT_1	-	Antitoxin
- (73692)	73692..73723	-	32	NuclAT_1	-	Antitoxin
- (73692)	73692..73723	-	32	NuclAT_1	-	Antitoxin
- (75165)	75165..75362	-	198	NuclAT_0	-	-
- (75165)	75165..75362	-	198	NuclAT_0	-	-
- (75165)	75165..75362	-	198	NuclAT_0	-	-
- (75165)	75165..75362	-	198	NuclAT_0	-	-
HUZ77_RS23990 (75174)	75174..75362	+	189	WP_001299721.1	hypothetical protein	-
HUZ77_RS23995 (75331)	75331..76093	-	763	Protein_98	plasmid SOS inhibition protein A	-
HUZ77_RS24000 (76090)	76090..76524	-	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
HUZ77_RS24005 (76579)	76579..76776	-	198	Protein_100	hypothetical protein	-
HUZ77_RS24010 (76804)	76804..77037	-	234	WP_000005990.1	DUF905 family protein	-
HUZ77_RS24015 (77105)	77105..77644	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
HUZ77_RS24020 (77670)	77670..77876	-	207	WP_000275856.1	hypothetical protein	-
HUZ77_RS24025 (78116)	78116..78367	-	252	WP_071579736.1	hypothetical protein	-
HUZ77_RS24030 (78286)	78286..78492	-	207	WP_001774176.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(M) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / floR / sul2 / tet(A) / lnu(F) / aac(3)-IId / aph(3')-Ia / sul3 / blaTEM-1B / sitABCD	iutA / iucD / iucC / iucB / iucA	1..154739	154739

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T161038 WP_001372321.1 NZ_CP055020:c73615-73490 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T161038 NZ_CP071013:c1080529-1080311 [Enterobacter hormaechei]
ATGTCTGATAAACCATTAACTAAAGTCGATTATTTGATGCGCCTGCGACGCTGTCAGTCAATTGACACGCTCGAACGAGT
TATTGAGAAAAATAAATACGAGCTGTCTGATAATGAACTGGCGGTATTTTATTCAGCTGCCGACCATCGTCTTGCTGAAC
TGACCATGAATAAACTCTATGACAAGATCCCCTCTTCGGTATGGAAATTTGTTCGTTAG

Antitoxin

Nucleotide

• Length: 32 bp

>AT161038 NZ_CP055020:c73723-73692 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin