Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 88403..88672 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP054980 | ||
| Organism | Shigella flexneri strain STIN_92 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | HUZ60_RS25855 | Protein ID | WP_001372321.1 |
| Coordinates | 88547..88672 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 88403..88468 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HUZ60_RS25805 | 83477..83704 | + | 228 | WP_071961421.1 | hypothetical protein | - |
| HUZ60_RS25810 | 83697..84032 | + | 336 | WP_014106969.1 | hypothetical protein | - |
| HUZ60_RS25815 | 83945..84151 | + | 207 | WP_000275853.1 | hypothetical protein | - |
| HUZ60_RS25820 | 84177..84716 | + | 540 | WP_032332913.1 | single-stranded DNA-binding protein | - |
| HUZ60_RS25825 | 84773..85006 | + | 234 | WP_000005987.1 | DUF905 family protein | - |
| HUZ60_RS25830 | 85071..87029 | + | 1959 | WP_039000998.1 | ParB/RepB/Spo0J family partition protein | - |
| HUZ60_RS25835 | 87084..87518 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| HUZ60_RS25840 | 87515..88234 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| HUZ60_RS25845 | 88246..88434 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 88246..88470 | + | 225 | NuclAT_0 | - | - |
| - | 88246..88470 | + | 225 | NuclAT_0 | - | - |
| - | 88246..88470 | + | 225 | NuclAT_0 | - | - |
| - | 88246..88470 | + | 225 | NuclAT_0 | - | - |
| - | 88403..88468 | + | 66 | - | - | Antitoxin |
| HUZ60_RS25850 | 88456..88605 | + | 150 | Protein_104 | plasmid maintenance protein Mok | - |
| HUZ60_RS25855 | 88547..88672 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| HUZ60_RS25860 | 88892..89122 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| HUZ60_RS25865 | 89120..89293 | - | 174 | Protein_107 | hypothetical protein | - |
| HUZ60_RS25870 | 89363..89569 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| HUZ60_RS25875 | 89594..89881 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| HUZ60_RS25880 | 90004..90825 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| HUZ60_RS25885 | 91122..91724 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| HUZ60_RS25890 | 92045..92428 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HUZ60_RS25895 | 92615..93304 | + | 690 | WP_039002187.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) / sul3 | - | 1..124795 | 124795 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T160807 WP_001372321.1 NZ_CP054980:88547-88672 [Shigella flexneri]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T160807 NZ_CP070924:8899-9147 [Escherichia coli]
ATGGGGAAAGCAGATAAGCTACTGGCAAAATTTTTAAACAGTAAAAAAACGTTTGAATGGGATGAACTCGTTGTTTTGTT
TTCTTCTCTAGGATATGTCAAAAAGGAAATGCAGGGATCAAGAGTGCGATTTTTCAATGCTGAAATTAATCACACAATAT
TAATGCATCGCCCACATCCAGAAAGTTATATTAAAGGTGGAACGCTGAAAGCTATTAAACAGAACTTGAAAGAGGCTGGG
GTTTTATGA
ATGGGGAAAGCAGATAAGCTACTGGCAAAATTTTTAAACAGTAAAAAAACGTTTGAATGGGATGAACTCGTTGTTTTGTT
TTCTTCTCTAGGATATGTCAAAAAGGAAATGCAGGGATCAAGAGTGCGATTTTTCAATGCTGAAATTAATCACACAATAT
TAATGCATCGCCCACATCCAGAAAGTTATATTAAAGGTGGAACGCTGAAAGCTATTAAACAGAACTTGAAAGAGGCTGGG
GTTTTATGA
Antitoxin
Download Length: 66 bp
>AT160807 NZ_CP054980:88403-88468 [Shigella flexneri]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|