Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 35048..35318 | Replicon | plasmid pKP20194c4-p2 |
| Accession | NZ_CP054746 | ||
| Organism | Klebsiella pneumoniae strain KP20194c4 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | HUS04_RS28160 | Protein ID | WP_001312861.1 |
| Coordinates | 35160..35318 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 35048..35111 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HUS04_RS28135 | 30759..31286 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| HUS04_RS28140 | 31344..31577 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| HUS04_RS28145 | 31638..33661 | + | 2024 | Protein_42 | ParB/RepB/Spo0J family partition protein | - |
| HUS04_RS28150 | 33730..34164 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| HUS04_RS28155 | 34161..34880 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 34892..35116 | + | 225 | NuclAT_0 | - | - |
| - | 34892..35116 | + | 225 | NuclAT_0 | - | - |
| - | 34892..35116 | + | 225 | NuclAT_0 | - | - |
| - | 34892..35116 | + | 225 | NuclAT_0 | - | - |
| - | 35048..35111 | - | 64 | - | - | Antitoxin |
| HUS04_RS28160 | 35160..35318 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| HUS04_RS28165 | 35556..35933 | - | 378 | Protein_46 | hypothetical protein | - |
| HUS04_RS28170 | 36233..36529 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| HUS04_RS28175 | 36640..37461 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| HUS04_RS28180 | 37758..38405 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| HUS04_RS28185 | 38682..39065 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| HUS04_RS28190 | 39346..40050 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..133772 | 133772 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T160243 WP_001312861.1 NZ_CP054746:35160-35318 [Klebsiella pneumoniae]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T160243 NZ_CP070410:4058754-4058972 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACCTCTGTCTGGAAATTTATCCGCTAA
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACCTCTGTCTGGAAATTTATCCGCTAA
Antitoxin
Download Length: 64 bp
>AT160243 NZ_CP054746:c35111-35048 [Klebsiella pneumoniae]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|