Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1264114..1264336 Replicon chromosome
Accession NZ_CP054665
Organism Escherichia coli strain IGC_EcoliInv_1.1

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag HUR94_RS06240 Protein ID WP_000170963.1
Coordinates 1264114..1264221 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1264269..1264336 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUR94_RS06210 (1259423) 1259423..1260505 + 1083 WP_000804726.1 peptide chain release factor 1 -
HUR94_RS06215 (1260505) 1260505..1261338 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
HUR94_RS06220 (1261335) 1261335..1261727 + 393 WP_000200374.1 invasion regulator SirB2 -
HUR94_RS06225 (1261731) 1261731..1262540 + 810 WP_001257044.1 invasion regulator SirB1 -
HUR94_RS06230 (1262576) 1262576..1263430 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HUR94_RS06235 (1263579) 1263579..1263686 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1263734) 1263734..1263800 + 67 NuclAT_34 - -
- (1263734) 1263734..1263800 + 67 NuclAT_34 - -
- (1263734) 1263734..1263800 + 67 NuclAT_34 - -
- (1263734) 1263734..1263800 + 67 NuclAT_34 - -
- (1263734) 1263734..1263800 + 67 NuclAT_36 - -
- (1263734) 1263734..1263800 + 67 NuclAT_36 - -
- (1263734) 1263734..1263800 + 67 NuclAT_36 - -
- (1263734) 1263734..1263800 + 67 NuclAT_36 - -
- (1263734) 1263734..1263800 + 67 NuclAT_38 - -
- (1263734) 1263734..1263800 + 67 NuclAT_38 - -
- (1263734) 1263734..1263800 + 67 NuclAT_38 - -
- (1263734) 1263734..1263800 + 67 NuclAT_38 - -
- (1263734) 1263734..1263800 + 67 NuclAT_40 - -
- (1263734) 1263734..1263800 + 67 NuclAT_40 - -
- (1263734) 1263734..1263800 + 67 NuclAT_40 - -
- (1263734) 1263734..1263800 + 67 NuclAT_40 - -
- (1263734) 1263734..1263800 + 67 NuclAT_42 - -
- (1263734) 1263734..1263800 + 67 NuclAT_42 - -
- (1263734) 1263734..1263800 + 67 NuclAT_42 - -
- (1263734) 1263734..1263800 + 67 NuclAT_42 - -
- (1263734) 1263734..1263800 + 67 NuclAT_44 - -
- (1263734) 1263734..1263800 + 67 NuclAT_44 - -
- (1263734) 1263734..1263800 + 67 NuclAT_44 - -
- (1263734) 1263734..1263800 + 67 NuclAT_44 - -
- (1263736) 1263736..1263801 + 66 NuclAT_18 - -
- (1263736) 1263736..1263801 + 66 NuclAT_18 - -
- (1263736) 1263736..1263801 + 66 NuclAT_18 - -
- (1263736) 1263736..1263801 + 66 NuclAT_18 - -
- (1263736) 1263736..1263801 + 66 NuclAT_21 - -
- (1263736) 1263736..1263801 + 66 NuclAT_21 - -
- (1263736) 1263736..1263801 + 66 NuclAT_21 - -
- (1263736) 1263736..1263801 + 66 NuclAT_21 - -
- (1263736) 1263736..1263801 + 66 NuclAT_24 - -
- (1263736) 1263736..1263801 + 66 NuclAT_24 - -
- (1263736) 1263736..1263801 + 66 NuclAT_24 - -
- (1263736) 1263736..1263801 + 66 NuclAT_24 - -
- (1263736) 1263736..1263801 + 66 NuclAT_27 - -
- (1263736) 1263736..1263801 + 66 NuclAT_27 - -
- (1263736) 1263736..1263801 + 66 NuclAT_27 - -
- (1263736) 1263736..1263801 + 66 NuclAT_27 - -
- (1263736) 1263736..1263801 + 66 NuclAT_30 - -
- (1263736) 1263736..1263801 + 66 NuclAT_30 - -
- (1263736) 1263736..1263801 + 66 NuclAT_30 - -
- (1263736) 1263736..1263801 + 66 NuclAT_30 - -
- (1263736) 1263736..1263801 + 66 NuclAT_33 - -
- (1263736) 1263736..1263801 + 66 NuclAT_33 - -
- (1263736) 1263736..1263801 + 66 NuclAT_33 - -
- (1263736) 1263736..1263801 + 66 NuclAT_33 - -
HUR94_RS06240 (1264114) 1264114..1264221 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1264270) 1264270..1264335 + 66 NuclAT_35 - -
- (1264270) 1264270..1264335 + 66 NuclAT_35 - -
- (1264270) 1264270..1264335 + 66 NuclAT_35 - -
- (1264270) 1264270..1264335 + 66 NuclAT_35 - -
- (1264270) 1264270..1264335 + 66 NuclAT_37 - -
- (1264270) 1264270..1264335 + 66 NuclAT_37 - -
- (1264270) 1264270..1264335 + 66 NuclAT_37 - -
- (1264270) 1264270..1264335 + 66 NuclAT_37 - -
- (1264270) 1264270..1264335 + 66 NuclAT_39 - -
- (1264270) 1264270..1264335 + 66 NuclAT_39 - -
- (1264270) 1264270..1264335 + 66 NuclAT_39 - -
- (1264270) 1264270..1264335 + 66 NuclAT_39 - -
- (1264270) 1264270..1264335 + 66 NuclAT_41 - -
- (1264270) 1264270..1264335 + 66 NuclAT_41 - -
- (1264270) 1264270..1264335 + 66 NuclAT_41 - -
- (1264270) 1264270..1264335 + 66 NuclAT_41 - -
- (1264270) 1264270..1264335 + 66 NuclAT_43 - -
- (1264270) 1264270..1264335 + 66 NuclAT_43 - -
- (1264270) 1264270..1264335 + 66 NuclAT_43 - -
- (1264270) 1264270..1264335 + 66 NuclAT_43 - -
- (1264270) 1264270..1264335 + 66 NuclAT_45 - -
- (1264270) 1264270..1264335 + 66 NuclAT_45 - -
- (1264270) 1264270..1264335 + 66 NuclAT_45 - -
- (1264270) 1264270..1264335 + 66 NuclAT_45 - -
- (1264269) 1264269..1264336 + 68 NuclAT_17 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_17 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_17 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_17 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_20 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_20 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_20 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_20 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_23 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_23 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_23 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_23 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_26 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_26 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_26 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_26 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_29 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_29 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_29 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_29 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_32 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_32 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_32 - Antitoxin
- (1264269) 1264269..1264336 + 68 NuclAT_32 - Antitoxin
HUR94_RS06245 (1264649) 1264649..1264756 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1264804) 1264804..1264871 + 68 NuclAT_16 - -
- (1264804) 1264804..1264871 + 68 NuclAT_16 - -
- (1264804) 1264804..1264871 + 68 NuclAT_16 - -
- (1264804) 1264804..1264871 + 68 NuclAT_16 - -
- (1264804) 1264804..1264871 + 68 NuclAT_19 - -
- (1264804) 1264804..1264871 + 68 NuclAT_19 - -
- (1264804) 1264804..1264871 + 68 NuclAT_19 - -
- (1264804) 1264804..1264871 + 68 NuclAT_19 - -
- (1264804) 1264804..1264871 + 68 NuclAT_22 - -
- (1264804) 1264804..1264871 + 68 NuclAT_22 - -
- (1264804) 1264804..1264871 + 68 NuclAT_22 - -
- (1264804) 1264804..1264871 + 68 NuclAT_22 - -
- (1264804) 1264804..1264871 + 68 NuclAT_25 - -
- (1264804) 1264804..1264871 + 68 NuclAT_25 - -
- (1264804) 1264804..1264871 + 68 NuclAT_25 - -
- (1264804) 1264804..1264871 + 68 NuclAT_25 - -
- (1264804) 1264804..1264871 + 68 NuclAT_28 - -
- (1264804) 1264804..1264871 + 68 NuclAT_28 - -
- (1264804) 1264804..1264871 + 68 NuclAT_28 - -
- (1264804) 1264804..1264871 + 68 NuclAT_28 - -
- (1264804) 1264804..1264871 + 68 NuclAT_31 - -
- (1264804) 1264804..1264871 + 68 NuclAT_31 - -
- (1264804) 1264804..1264871 + 68 NuclAT_31 - -
- (1264804) 1264804..1264871 + 68 NuclAT_31 - -
HUR94_RS06250 (1265160) 1265160..1266260 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
HUR94_RS06255 (1266530) 1266530..1266760 + 231 WP_001146444.1 putative cation transport regulator ChaB -
HUR94_RS06260 (1266918) 1266918..1267613 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
HUR94_RS06265 (1267657) 1267657..1268010 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T160034 WP_000170963.1 NZ_CP054665:c1264221-1264114 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T160034 NZ_CP070283:6572-6859 [Escherichia albertii]
ATGACTTACACAGTCAAATTCAGGGATGATGCACTGAAAGAGTGGCTGAAGCTGGATAAGGCCATTCAACAGCAGTTTGC
GAAAAAGCTAAAGAAGTGCAGTGAAAATCCTCATATTCCCTCAGCTAAGCTGCGCGGGATAAAAGACTGCTACAAAATCA
AATTACGTGCGTCTGGTTTTCGTCTGGTCTATCAGGTGATTGATGATCAATTAATTATCGCTGTTGTTGCTGTAGGGAAA
CGTGAACGTAGTGATGTTTATCAACTTGCCAGCGAACGAATGAGGTAA

Antitoxin


Download         Length: 68 bp

>AT160034 NZ_CP054665:1264269-1264336 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References