Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 42778..43047 | Replicon | plasmid unnamed1 |
Accession | NZ_CP054663 | ||
Organism | Escherichia coli strain IGC_RcoliRes_1.1 |
Toxin (Protein)
Gene name | hok | Uniprot ID | G9G195 |
Locus tag | HUR93_RS25940 | Protein ID | WP_001323520.1 |
Coordinates | 42931..43047 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 42778..42843 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUR93_RS25900 | 37868..38098 | + | 231 | WP_001380705.1 | hypothetical protein | - |
HUR93_RS25905 | 38571..39098 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
HUR93_RS25910 | 39154..39387 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
HUR93_RS25915 | 39446..41404 | + | 1959 | WP_061892140.1 | ParB/RepB/Spo0J family partition protein | - |
HUR93_RS25920 | 41459..41893 | + | 435 | WP_061892139.1 | conjugation system SOS inhibitor PsiB | - |
HUR93_RS25925 | 41890..42652 | + | 763 | Protein_52 | plasmid SOS inhibition protein A | - |
HUR93_RS25930 | 42621..42809 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 42621..42845 | + | 225 | NuclAT_0 | - | - |
- | 42621..42845 | + | 225 | NuclAT_0 | - | - |
- | 42621..42845 | + | 225 | NuclAT_0 | - | - |
- | 42621..42845 | + | 225 | NuclAT_0 | - | - |
- | 42778..42843 | + | 66 | - | - | Antitoxin |
HUR93_RS25935 | 42831..42980 | + | 150 | Protein_54 | plasmid maintenance protein Mok | - |
HUR93_RS25940 | 42931..43047 | + | 117 | WP_001323520.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
HUR93_RS25945 | 43267..43497 | + | 231 | WP_001426396.1 | hypothetical protein | - |
HUR93_RS25950 | 43495..43668 | - | 174 | Protein_57 | hypothetical protein | - |
HUR93_RS25955 | 43738..43944 | + | 207 | WP_000547974.1 | hypothetical protein | - |
HUR93_RS25960 | 43969..44256 | + | 288 | WP_000107535.1 | hypothetical protein | - |
HUR93_RS25965 | 44376..45197 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
HUR93_RS25970 | 45494..46084 | - | 591 | WP_165850686.1 | transglycosylase SLT domain-containing protein | - |
HUR93_RS25975 | 46419..46802 | + | 384 | WP_046201845.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
HUR93_RS25980 | 46998..47669 | + | 672 | WP_237897983.1 | conjugal transfer transcriptional regulator TraJ | - |
HUR93_RS25985 | 47806..48033 | + | 228 | WP_000089265.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..108557 | 108557 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4455.23 Da Isoelectric Point: 8.5110
>T160027 WP_001323520.1 NZ_CP054663:42931-43047 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 117 bp
>T160027 NZ_CP070281:3431474-3431692 [Escherichia albertii]
ATGTCCGATAAACCTTTAACAAAAACCGATTATTTGATGCGTCTGCGTCGTTGCCAGACAATTGACACGCTGGAACGTGT
TATCGAGAAAAATAAATATGAATTATCAGATAATGAATTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTTGCAGAGC
TGACTATGAATAAGCTATATGACAAGATCCCTTCCTCAGTGTGGAAATTCATTCGGTAA
ATGTCCGATAAACCTTTAACAAAAACCGATTATTTGATGCGTCTGCGTCGTTGCCAGACAATTGACACGCTGGAACGTGT
TATCGAGAAAAATAAATATGAATTATCAGATAATGAATTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTTGCAGAGC
TGACTATGAATAAGCTATATGACAAGATCCCTTCCTCAGTGTGGAAATTCATTCGGTAA
Antitoxin
Download Length: 66 bp
>AT160027 NZ_CP054663:42778-42843 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|