Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 579113..579807 | Replicon | chromosome |
Accession | NZ_CP054619 | ||
Organism | Azospirillum oryzae strain KACC 14407 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | HUE56_RS11735 | Protein ID | WP_149197840.1 |
Coordinates | 579448..579807 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | HUE56_RS11730 | Protein ID | WP_149197839.1 |
Coordinates | 579113..579451 (-) | Length | 113 a.a. |
Genomic Context
Location: 576268..578961 (2694 bp)
Type: Others
Protein ID: WP_149197838.1
Type: Others
Protein ID: WP_149197838.1
Location: 579880..580026 (147 bp)
Type: Others
Protein ID: WP_211101041.1
Type: Others
Protein ID: WP_211101041.1
Location: 579113..579451 (339 bp)
Type: Antitoxin
Protein ID: WP_149197839.1
Type: Antitoxin
Protein ID: WP_149197839.1
Location: 579448..579807 (360 bp)
Type: Toxin
Protein ID: WP_149197840.1
Type: Toxin
Protein ID: WP_149197840.1
Location: 580401..580670 (270 bp)
Type: Others
Protein ID: WP_149197841.1
Type: Others
Protein ID: WP_149197841.1
Location: 580661..580834 (174 bp)
Type: Others
Protein ID: WP_149197842.1
Type: Others
Protein ID: WP_149197842.1
Location: 581128..582288 (1161 bp)
Type: Others
Protein ID: WP_174757212.1
Type: Others
Protein ID: WP_174757212.1
Location: 582367..583065 (699 bp)
Type: Others
Protein ID: WP_149197844.1
Type: Others
Protein ID: WP_149197844.1
Location: 583338..583703 (366 bp)
Type: Others
Protein ID: WP_149197845.1
Type: Others
Protein ID: WP_149197845.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUE56_RS11725 | 576268..578961 | + | 2694 | WP_149197838.1 | pyruvate, phosphate dikinase | - |
HUE56_RS11730 | 579113..579451 | - | 339 | WP_149197839.1 | XRE family transcriptional regulator | Antitoxin |
HUE56_RS11735 | 579448..579807 | - | 360 | WP_149197840.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
HUE56_RS11740 | 579880..580026 | + | 147 | WP_211101041.1 | hypothetical protein | - |
HUE56_RS11745 | 580401..580670 | - | 270 | WP_149197841.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
HUE56_RS11750 | 580661..580834 | - | 174 | WP_149197842.1 | antitoxin | - |
HUE56_RS11755 | 581128..582288 | - | 1161 | WP_174757212.1 | XRE family transcriptional regulator | - |
HUE56_RS11760 | 582367..583065 | - | 699 | WP_149197844.1 | hypothetical protein | - |
HUE56_RS11765 | 583338..583703 | - | 366 | WP_149197845.1 | MarR family transcriptional regulator | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 12982.84 Da Isoelectric Point: 10.6473
>T159979 WP_149197840.1 NZ_CP054619:c579807-579448 [Azospirillum oryzae]
MHTVLFHTAFAAEFRALPHAVRIDLAAAAKVLGERGPALGRPHVDTLNGSRHANMKELRFKSNGGVWRVAFAFDPKRNAV
VLVAGDKSGVSEKRFYASLIATADSRYDDHLSDLKGTKP
MHTVLFHTAFAAEFRALPHAVRIDLAAAAKVLGERGPALGRPHVDTLNGSRHANMKELRFKSNGGVWRVAFAFDPKRNAV
VLVAGDKSGVSEKRFYASLIATADSRYDDHLSDLKGTKP
Download Length: 360 bp
>T159979 NZ_CP070229:3196754-3196861 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 113 a.a. Molecular weight: 12155.83 Da Isoelectric Point: 4.7147
>AT159979 WP_149197839.1 NZ_CP054619:c579451-579113 [Azospirillum oryzae]
MTATIPFDQILSEMTDDERAAVDARAAGMLAEIDGLAELRRLAELTQGQVAETLNVKQPTVHQIEKRTDLYLSTLRRFVE
AAGGELELRVSLPGKGAFKLTGIGELTSGSQR
MTATIPFDQILSEMTDDERAAVDARAAGMLAEIDGLAELRRLAELTQGQVAETLNVKQPTVHQIEKRTDLYLSTLRRFVE
AAGGELELRVSLPGKGAFKLTGIGELTSGSQR
Download Length: 339 bp
>AT159979 NZ_CP070229:c3196706-3196640 [Escherichia coli]
GGTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GGTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT