Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 35133..35281 | Replicon | plasmid pUTI-050-1 |
Accession | NZ_CP054576 | ||
Organism | Staphylococcus saprophyticus strain UTI-050 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | HSZ50_RS13115 | Protein ID | WP_011276848.1 |
Coordinates | 35133..35228 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 35246..35281 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HSZ50_RS13075 | 30514..31188 | + | 675 | WP_001105987.1 | IS6-like element IS257 family transposase | - |
HSZ50_RS13080 | 31393..32244 | + | 852 | WP_040030568.1 | NmrA family NAD(P)-binding protein | - |
HSZ50_RS13085 | 32507..32659 | + | 153 | WP_158501055.1 | hypothetical protein | - |
HSZ50_RS13090 | 32733..32900 | - | 168 | WP_162837505.1 | hypothetical protein | - |
HSZ50_RS13095 | 32931..33161 | - | 231 | WP_031884148.1 | SHOCT domain-containing protein | - |
HSZ50_RS13100 | 33295..33495 | - | 201 | WP_073346352.1 | hypothetical protein | - |
HSZ50_RS13105 | 33984..34601 | + | 618 | WP_002467537.1 | CadD family cadmium resistance transporter | - |
HSZ50_RS13110 | 34620..34967 | + | 348 | WP_002467551.1 | metalloregulator ArsR/SmtB family transcription factor | - |
HSZ50_RS13115 | 35133..35228 | + | 96 | WP_011276848.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 35246..35281 | + | 36 | NuclAT_0 | - | Antitoxin |
HSZ50_RS13120 | 35583..36056 | + | 474 | WP_077460978.1 | thymidylate synthase | - |
HSZ50_RS13125 | 36170..36598 | + | 429 | WP_031885498.1 | Rrf2 family transcriptional regulator | - |
HSZ50_RS13130 | 36719..37294 | + | 576 | Protein_42 | DsbA family protein | - |
HSZ50_RS13135 | 37311..37961 | + | 651 | WP_031885497.1 | NAD(P)-dependent oxidoreductase | - |
HSZ50_RS13140 | 38260..39015 | - | 756 | WP_031863945.1 | sulfite exporter TauE/SafE family protein | - |
HSZ50_RS13145 | 39015..39275 | - | 261 | WP_031863946.1 | persulfide-sensing transcriptional repressor CstR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..41251 | 41251 | |
- | flank | IS/Tn | - | - | 30514..31188 | 674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3623.38 Da Isoelectric Point: 9.5124
>T159920 WP_011276848.1 NZ_CP054576:35133-35228 [Staphylococcus saprophyticus]
MLEILVHITTTVISGCIIALFTHWLRNRKDK
MLEILVHITTTVISGCIIALFTHWLRNRKDK
Download Length: 96 bp
>T159920 NZ_CP070170:c4335179-4335006 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 36 bp
>AT159920 NZ_CP054576:35246-35281 [Staphylococcus saprophyticus]
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
TACAAAAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|