Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 545730..545887 | Replicon | chromosome |
Accession | NZ_CP054444 | ||
Organism | Staphylococcus saprophyticus strain UTI-056 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | HSZ51_RS02740 | Protein ID | WP_002441941.1 |
Coordinates | 545792..545887 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 545730..545763 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HSZ51_RS02715 | 541517..542350 | + | 834 | WP_048787569.1 | aldo/keto reductase | - |
HSZ51_RS02720 | 542817..543116 | - | 300 | WP_011304021.1 | hypothetical protein | - |
HSZ51_RS02725 | 543493..543726 | + | 234 | WP_048787568.1 | ferrous iron transport protein A | - |
HSZ51_RS02730 | 543787..543852 | - | 66 | WP_162009580.1 | type I toxin-antitoxin system Fst family toxin | - |
HSZ51_RS02735 | 544040..545434 | - | 1395 | WP_048787567.1 | RES family NAD+ phosphorylase | - |
- | 545730..545763 | + | 34 | - | - | Antitoxin |
HSZ51_RS02740 | 545792..545887 | - | 96 | WP_002441941.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
HSZ51_RS02745 | 546190..546948 | - | 759 | WP_011304024.1 | MerR family transcriptional regulator | - |
HSZ51_RS02750 | 547058..547621 | - | 564 | WP_048787566.1 | helix-turn-helix domain-containing protein | - |
HSZ51_RS02755 | 547815..549272 | - | 1458 | WP_011304026.1 | carbon starvation protein A | - |
HSZ51_RS02760 | 549480..550319 | - | 840 | WP_002481957.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3560.34 Da Isoelectric Point: 9.9256
>T159755 WP_002441941.1 NZ_CP054444:c545887-545792 [Staphylococcus saprophyticus]
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
Download Length: 96 bp
>T159755 NZ_CP070124:4925796-4925948 [Escherichia coli]
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
ATGAAGCAGCATAAGGCGATGATTGTCGCCCTGATCGTCATCTGTATCACCGCCGTAGTGGCGGCGCTGGTAACGAGAAA
AGACCTCTGTGAGGTTCACATCCGAACTGGCCAGACGGAGGTTGCTGTTTTCACGGCTTACGAATCCGAGTAA
Antitoxin
Download Length: 34 bp
>AT159755 NZ_CP054444:545730-545763 [Staphylococcus saprophyticus]
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|