Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2559190..2559347 | Replicon | chromosome |
Accession | NZ_CP054434 | ||
Organism | Staphylococcus saprophyticus strain UTI-035 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | HSZ47_RS12555 | Protein ID | WP_002441941.1 |
Coordinates | 2559252..2559347 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2559190..2559223 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HSZ47_RS12530 | 2554977..2555810 | + | 834 | WP_048787569.1 | aldo/keto reductase | - |
HSZ47_RS12535 | 2556277..2556576 | - | 300 | WP_011304021.1 | hypothetical protein | - |
HSZ47_RS12540 | 2556953..2557186 | + | 234 | WP_011304022.1 | ferrous iron transport protein A | - |
HSZ47_RS12545 | 2557247..2557312 | - | 66 | WP_162009580.1 | type I toxin-antitoxin system Fst family toxin | - |
HSZ47_RS12550 | 2557500..2558894 | - | 1395 | WP_069822293.1 | RES family NAD+ phosphorylase | - |
- | 2559190..2559223 | + | 34 | - | - | Antitoxin |
HSZ47_RS12555 | 2559252..2559347 | - | 96 | WP_002441941.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
HSZ47_RS12560 | 2559650..2560408 | - | 759 | WP_174538817.1 | MerR family transcriptional regulator | - |
HSZ47_RS12565 | 2560519..2561082 | - | 564 | WP_063488859.1 | helix-turn-helix domain-containing protein | - |
HSZ47_RS12570 | 2561276..2562733 | - | 1458 | WP_063488860.1 | carbon starvation protein A | - |
HSZ47_RS12575 | 2562941..2563780 | - | 840 | WP_002481957.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3560.34 Da Isoelectric Point: 9.9256
>T159740 WP_002441941.1 NZ_CP054434:c2559347-2559252 [Staphylococcus saprophyticus]
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
MLMIFVHIIAPVISGCAVAYFTYWLSSKRNK
Download Length: 96 bp
>T159740 NZ_CP070124:1107730-1107837 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCACGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCACGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 34 bp
>AT159740 NZ_CP054434:2559190-2559223 [Staphylococcus saprophyticus]
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
CACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|