Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2167875..2168095 Replicon chromosome
Accession NZ_CP054407
Organism Escherichia coli strain KCJ3K291

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag FR957_RS10615 Protein ID WP_000170954.1
Coordinates 2167875..2167982 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2168032..2168095 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FR957_RS10590 (2163719) 2163719..2164801 + 1083 WP_000804726.1 peptide chain release factor 1 -
FR957_RS10595 (2164801) 2164801..2165634 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
FR957_RS10600 (2165631) 2165631..2166023 + 393 WP_000200378.1 invasion regulator SirB2 -
FR957_RS10605 (2166027) 2166027..2166836 + 810 WP_001257044.1 invasion regulator SirB1 -
FR957_RS10610 (2166872) 2166872..2167726 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
FR957_RS10615 (2167875) 2167875..2167982 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2168032) 2168032..2168095 + 64 NuclAT_46 - Antitoxin
- (2168032) 2168032..2168095 + 64 NuclAT_46 - Antitoxin
- (2168032) 2168032..2168095 + 64 NuclAT_46 - Antitoxin
- (2168032) 2168032..2168095 + 64 NuclAT_46 - Antitoxin
- (2168032) 2168032..2168095 + 64 NuclAT_49 - Antitoxin
- (2168032) 2168032..2168095 + 64 NuclAT_49 - Antitoxin
- (2168032) 2168032..2168095 + 64 NuclAT_49 - Antitoxin
- (2168032) 2168032..2168095 + 64 NuclAT_49 - Antitoxin
FR957_RS10620 (2168410) 2168410..2168517 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2168570) 2168570..2168631 + 62 NuclAT_45 - -
- (2168570) 2168570..2168631 + 62 NuclAT_45 - -
- (2168570) 2168570..2168631 + 62 NuclAT_45 - -
- (2168570) 2168570..2168631 + 62 NuclAT_45 - -
- (2168570) 2168570..2168631 + 62 NuclAT_48 - -
- (2168570) 2168570..2168631 + 62 NuclAT_48 - -
- (2168570) 2168570..2168631 + 62 NuclAT_48 - -
- (2168570) 2168570..2168631 + 62 NuclAT_48 - -
- (2168570) 2168570..2168633 + 64 NuclAT_15 - -
- (2168570) 2168570..2168633 + 64 NuclAT_15 - -
- (2168570) 2168570..2168633 + 64 NuclAT_15 - -
- (2168570) 2168570..2168633 + 64 NuclAT_15 - -
- (2168570) 2168570..2168633 + 64 NuclAT_17 - -
- (2168570) 2168570..2168633 + 64 NuclAT_17 - -
- (2168570) 2168570..2168633 + 64 NuclAT_17 - -
- (2168570) 2168570..2168633 + 64 NuclAT_17 - -
- (2168570) 2168570..2168633 + 64 NuclAT_19 - -
- (2168570) 2168570..2168633 + 64 NuclAT_19 - -
- (2168570) 2168570..2168633 + 64 NuclAT_19 - -
- (2168570) 2168570..2168633 + 64 NuclAT_19 - -
- (2168570) 2168570..2168633 + 64 NuclAT_21 - -
- (2168570) 2168570..2168633 + 64 NuclAT_21 - -
- (2168570) 2168570..2168633 + 64 NuclAT_21 - -
- (2168570) 2168570..2168633 + 64 NuclAT_21 - -
- (2168570) 2168570..2168633 + 64 NuclAT_23 - -
- (2168570) 2168570..2168633 + 64 NuclAT_23 - -
- (2168570) 2168570..2168633 + 64 NuclAT_23 - -
- (2168570) 2168570..2168633 + 64 NuclAT_23 - -
- (2168570) 2168570..2168633 + 64 NuclAT_25 - -
- (2168570) 2168570..2168633 + 64 NuclAT_25 - -
- (2168570) 2168570..2168633 + 64 NuclAT_25 - -
- (2168570) 2168570..2168633 + 64 NuclAT_25 - -
FR957_RS10625 (2168946) 2168946..2169053 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2169101) 2169101..2169166 + 66 NuclAT_44 - -
- (2169101) 2169101..2169166 + 66 NuclAT_44 - -
- (2169101) 2169101..2169166 + 66 NuclAT_44 - -
- (2169101) 2169101..2169166 + 66 NuclAT_44 - -
- (2169101) 2169101..2169166 + 66 NuclAT_47 - -
- (2169101) 2169101..2169166 + 66 NuclAT_47 - -
- (2169101) 2169101..2169166 + 66 NuclAT_47 - -
- (2169101) 2169101..2169166 + 66 NuclAT_47 - -
- (2169101) 2169101..2169168 + 68 NuclAT_14 - -
- (2169101) 2169101..2169168 + 68 NuclAT_14 - -
- (2169101) 2169101..2169168 + 68 NuclAT_14 - -
- (2169101) 2169101..2169168 + 68 NuclAT_14 - -
- (2169101) 2169101..2169168 + 68 NuclAT_16 - -
- (2169101) 2169101..2169168 + 68 NuclAT_16 - -
- (2169101) 2169101..2169168 + 68 NuclAT_16 - -
- (2169101) 2169101..2169168 + 68 NuclAT_16 - -
- (2169101) 2169101..2169168 + 68 NuclAT_18 - -
- (2169101) 2169101..2169168 + 68 NuclAT_18 - -
- (2169101) 2169101..2169168 + 68 NuclAT_18 - -
- (2169101) 2169101..2169168 + 68 NuclAT_18 - -
- (2169101) 2169101..2169168 + 68 NuclAT_20 - -
- (2169101) 2169101..2169168 + 68 NuclAT_20 - -
- (2169101) 2169101..2169168 + 68 NuclAT_20 - -
- (2169101) 2169101..2169168 + 68 NuclAT_20 - -
- (2169101) 2169101..2169168 + 68 NuclAT_22 - -
- (2169101) 2169101..2169168 + 68 NuclAT_22 - -
- (2169101) 2169101..2169168 + 68 NuclAT_22 - -
- (2169101) 2169101..2169168 + 68 NuclAT_22 - -
- (2169101) 2169101..2169168 + 68 NuclAT_24 - -
- (2169101) 2169101..2169168 + 68 NuclAT_24 - -
- (2169101) 2169101..2169168 + 68 NuclAT_24 - -
- (2169101) 2169101..2169168 + 68 NuclAT_24 - -
FR957_RS10630 (2169458) 2169458..2170558 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
FR957_RS10635 (2170828) 2170828..2171058 + 231 WP_001146442.1 putative cation transport regulator ChaB -
FR957_RS10640 (2171216) 2171216..2171911 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
FR957_RS10645 (2171955) 2171955..2172308 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T159668 WP_000170954.1 NZ_CP054407:c2167982-2167875 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T159668 NZ_CP070103:c4112690-4112587 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT

Antitoxin


Download         Length: 64 bp

>AT159668 NZ_CP054407:2168032-2168095 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTAAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References