Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1380035..1380255 Replicon chromosome
Accession NZ_CP054388
Organism Escherichia coli strain 1517k

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag E2126_RS06470 Protein ID WP_000170954.1
Coordinates 1380035..1380142 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1380192..1380255 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E2126_RS06445 1375879..1376961 + 1083 WP_000804726.1 peptide chain release factor 1 -
E2126_RS06450 1376961..1377794 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
E2126_RS06455 1377791..1378183 + 393 WP_000200374.1 invasion regulator SirB2 -
E2126_RS06460 1378187..1378996 + 810 WP_001257044.1 invasion regulator SirB1 -
E2126_RS06465 1379032..1379886 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
E2126_RS06470 1380035..1380142 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1380192..1380255 + 64 NuclAT_51 - Antitoxin
- 1380192..1380255 + 64 NuclAT_51 - Antitoxin
- 1380192..1380255 + 64 NuclAT_51 - Antitoxin
- 1380192..1380255 + 64 NuclAT_51 - Antitoxin
- 1380192..1380255 + 64 NuclAT_54 - Antitoxin
- 1380192..1380255 + 64 NuclAT_54 - Antitoxin
- 1380192..1380255 + 64 NuclAT_54 - Antitoxin
- 1380192..1380255 + 64 NuclAT_54 - Antitoxin
- 1380192..1380255 + 64 NuclAT_57 - Antitoxin
- 1380192..1380255 + 64 NuclAT_57 - Antitoxin
- 1380192..1380255 + 64 NuclAT_57 - Antitoxin
- 1380192..1380255 + 64 NuclAT_57 - Antitoxin
- 1380192..1380255 + 64 NuclAT_60 - Antitoxin
- 1380192..1380255 + 64 NuclAT_60 - Antitoxin
- 1380192..1380255 + 64 NuclAT_60 - Antitoxin
- 1380192..1380255 + 64 NuclAT_60 - Antitoxin
E2126_RS06475 1380570..1380677 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1380730..1380791 + 62 NuclAT_50 - -
- 1380730..1380791 + 62 NuclAT_50 - -
- 1380730..1380791 + 62 NuclAT_50 - -
- 1380730..1380791 + 62 NuclAT_50 - -
- 1380730..1380791 + 62 NuclAT_53 - -
- 1380730..1380791 + 62 NuclAT_53 - -
- 1380730..1380791 + 62 NuclAT_53 - -
- 1380730..1380791 + 62 NuclAT_53 - -
- 1380730..1380791 + 62 NuclAT_56 - -
- 1380730..1380791 + 62 NuclAT_56 - -
- 1380730..1380791 + 62 NuclAT_56 - -
- 1380730..1380791 + 62 NuclAT_56 - -
- 1380730..1380791 + 62 NuclAT_59 - -
- 1380730..1380791 + 62 NuclAT_59 - -
- 1380730..1380791 + 62 NuclAT_59 - -
- 1380730..1380791 + 62 NuclAT_59 - -
- 1380730..1380793 + 64 NuclAT_13 - -
- 1380730..1380793 + 64 NuclAT_13 - -
- 1380730..1380793 + 64 NuclAT_13 - -
- 1380730..1380793 + 64 NuclAT_13 - -
- 1380730..1380793 + 64 NuclAT_15 - -
- 1380730..1380793 + 64 NuclAT_15 - -
- 1380730..1380793 + 64 NuclAT_15 - -
- 1380730..1380793 + 64 NuclAT_15 - -
- 1380730..1380793 + 64 NuclAT_17 - -
- 1380730..1380793 + 64 NuclAT_17 - -
- 1380730..1380793 + 64 NuclAT_17 - -
- 1380730..1380793 + 64 NuclAT_17 - -
- 1380730..1380793 + 64 NuclAT_19 - -
- 1380730..1380793 + 64 NuclAT_19 - -
- 1380730..1380793 + 64 NuclAT_19 - -
- 1380730..1380793 + 64 NuclAT_19 - -
- 1380730..1380793 + 64 NuclAT_21 - -
- 1380730..1380793 + 64 NuclAT_21 - -
- 1380730..1380793 + 64 NuclAT_21 - -
- 1380730..1380793 + 64 NuclAT_21 - -
- 1380730..1380793 + 64 NuclAT_23 - -
- 1380730..1380793 + 64 NuclAT_23 - -
- 1380730..1380793 + 64 NuclAT_23 - -
- 1380730..1380793 + 64 NuclAT_23 - -
E2126_RS06480 1381106..1381213 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1381261..1381326 + 66 NuclAT_49 - -
- 1381261..1381326 + 66 NuclAT_49 - -
- 1381261..1381326 + 66 NuclAT_49 - -
- 1381261..1381326 + 66 NuclAT_49 - -
- 1381261..1381326 + 66 NuclAT_52 - -
- 1381261..1381326 + 66 NuclAT_52 - -
- 1381261..1381326 + 66 NuclAT_52 - -
- 1381261..1381326 + 66 NuclAT_52 - -
- 1381261..1381326 + 66 NuclAT_55 - -
- 1381261..1381326 + 66 NuclAT_55 - -
- 1381261..1381326 + 66 NuclAT_55 - -
- 1381261..1381326 + 66 NuclAT_55 - -
- 1381261..1381326 + 66 NuclAT_58 - -
- 1381261..1381326 + 66 NuclAT_58 - -
- 1381261..1381326 + 66 NuclAT_58 - -
- 1381261..1381326 + 66 NuclAT_58 - -
- 1381261..1381328 + 68 NuclAT_12 - -
- 1381261..1381328 + 68 NuclAT_12 - -
- 1381261..1381328 + 68 NuclAT_12 - -
- 1381261..1381328 + 68 NuclAT_12 - -
- 1381261..1381328 + 68 NuclAT_14 - -
- 1381261..1381328 + 68 NuclAT_14 - -
- 1381261..1381328 + 68 NuclAT_14 - -
- 1381261..1381328 + 68 NuclAT_14 - -
- 1381261..1381328 + 68 NuclAT_16 - -
- 1381261..1381328 + 68 NuclAT_16 - -
- 1381261..1381328 + 68 NuclAT_16 - -
- 1381261..1381328 + 68 NuclAT_16 - -
- 1381261..1381328 + 68 NuclAT_18 - -
- 1381261..1381328 + 68 NuclAT_18 - -
- 1381261..1381328 + 68 NuclAT_18 - -
- 1381261..1381328 + 68 NuclAT_18 - -
- 1381261..1381328 + 68 NuclAT_20 - -
- 1381261..1381328 + 68 NuclAT_20 - -
- 1381261..1381328 + 68 NuclAT_20 - -
- 1381261..1381328 + 68 NuclAT_20 - -
- 1381261..1381328 + 68 NuclAT_22 - -
- 1381261..1381328 + 68 NuclAT_22 - -
- 1381261..1381328 + 68 NuclAT_22 - -
- 1381261..1381328 + 68 NuclAT_22 - -
E2126_RS06485 1381618..1382718 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
E2126_RS06490 1382988..1383218 + 231 WP_001146442.1 putative cation transport regulator ChaB -
E2126_RS06495 1383376..1384071 + 696 WP_012311798.1 glutathione-specific gamma-glutamylcyclotransferase -
E2126_RS06500 1384115..1384468 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T159568 WP_000170954.1 NZ_CP054388:c1380142-1380035 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T159568 NZ_CP070077:3233704-3234039 [Escherichia coli]
ATGGTAAGCCGATACGTACCCGATATGGGCGATCTGATTTGGGTTGATTTTGACCCGACAAAAGGTAGCGAGCAAGCCGG
ACATCGTCCGGCTGTTGTCCTGAGTCCGTTCATGTACAACAACAAAACAGGTATGTGTCTGTGTGTTCCTTGTACAACGC
AATCAAAAGGATATCCGTTCGAAGTTGTTTTATCCGGTCAGGAACGTGATGGCGTAGCGTTAGCTGAGCAGGTAAAAAGT
ATCGCCTGGCGGGCAAGAGGAGCAACGAAGAAAGGAACGGTTGCCCCAGAGGAATTACAGCTCATTAAAGCCAAAATTAA
CGTGCTGATTGGGTAG

Antitoxin


Download         Length: 64 bp

>AT159568 NZ_CP054388:1380192-1380255 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9


Antitoxin

Download structure file

References