Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1380035..1380255 | Replicon | chromosome |
| Accession | NZ_CP054388 | ||
| Organism | Escherichia coli strain 1517k | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | E2126_RS06470 | Protein ID | WP_000170954.1 |
| Coordinates | 1380035..1380142 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1380192..1380255 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E2126_RS06445 | 1375879..1376961 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| E2126_RS06450 | 1376961..1377794 | + | 834 | WP_000456458.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| E2126_RS06455 | 1377791..1378183 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| E2126_RS06460 | 1378187..1378996 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| E2126_RS06465 | 1379032..1379886 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| E2126_RS06470 | 1380035..1380142 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1380192..1380255 | + | 64 | NuclAT_51 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_51 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_51 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_51 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_54 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_54 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_54 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_54 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_57 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_57 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_57 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_57 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_60 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_60 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_60 | - | Antitoxin |
| - | 1380192..1380255 | + | 64 | NuclAT_60 | - | Antitoxin |
| E2126_RS06475 | 1380570..1380677 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1380730..1380791 | + | 62 | NuclAT_50 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_50 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_50 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_50 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_53 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_53 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_53 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_53 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_56 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_56 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_56 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_56 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_59 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_59 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_59 | - | - |
| - | 1380730..1380791 | + | 62 | NuclAT_59 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_13 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_13 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_13 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_13 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_15 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_15 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_15 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_15 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_17 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_17 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_17 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_17 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_19 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_19 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_19 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_19 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_21 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_21 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_21 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_21 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_23 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_23 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_23 | - | - |
| - | 1380730..1380793 | + | 64 | NuclAT_23 | - | - |
| E2126_RS06480 | 1381106..1381213 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1381261..1381326 | + | 66 | NuclAT_49 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_49 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_49 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_49 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_52 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_52 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_52 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_52 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_55 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_55 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_55 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_55 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_58 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_58 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_58 | - | - |
| - | 1381261..1381326 | + | 66 | NuclAT_58 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_12 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_12 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_12 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_12 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_14 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_14 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_14 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_14 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_16 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_16 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_16 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_16 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_18 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_18 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_18 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_18 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_20 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_20 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_20 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_20 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_22 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_22 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_22 | - | - |
| - | 1381261..1381328 | + | 68 | NuclAT_22 | - | - |
| E2126_RS06485 | 1381618..1382718 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| E2126_RS06490 | 1382988..1383218 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| E2126_RS06495 | 1383376..1384071 | + | 696 | WP_012311798.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| E2126_RS06500 | 1384115..1384468 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T159568 WP_000170954.1 NZ_CP054388:c1380142-1380035 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T159568 NZ_CP070077:3233704-3234039 [Escherichia coli]
ATGGTAAGCCGATACGTACCCGATATGGGCGATCTGATTTGGGTTGATTTTGACCCGACAAAAGGTAGCGAGCAAGCCGG
ACATCGTCCGGCTGTTGTCCTGAGTCCGTTCATGTACAACAACAAAACAGGTATGTGTCTGTGTGTTCCTTGTACAACGC
AATCAAAAGGATATCCGTTCGAAGTTGTTTTATCCGGTCAGGAACGTGATGGCGTAGCGTTAGCTGAGCAGGTAAAAAGT
ATCGCCTGGCGGGCAAGAGGAGCAACGAAGAAAGGAACGGTTGCCCCAGAGGAATTACAGCTCATTAAAGCCAAAATTAA
CGTGCTGATTGGGTAG
ATGGTAAGCCGATACGTACCCGATATGGGCGATCTGATTTGGGTTGATTTTGACCCGACAAAAGGTAGCGAGCAAGCCGG
ACATCGTCCGGCTGTTGTCCTGAGTCCGTTCATGTACAACAACAAAACAGGTATGTGTCTGTGTGTTCCTTGTACAACGC
AATCAAAAGGATATCCGTTCGAAGTTGTTTTATCCGGTCAGGAACGTGATGGCGTAGCGTTAGCTGAGCAGGTAAAAAGT
ATCGCCTGGCGGGCAAGAGGAGCAACGAAGAAAGGAACGGTTGCCCCAGAGGAATTACAGCTCATTAAAGCCAAAATTAA
CGTGCTGATTGGGTAG
Antitoxin
Download Length: 64 bp
>AT159568 NZ_CP054388:1380192-1380255 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|