Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3290221..3290477 | Replicon | chromosome |
Accession | NZ_CP054368 | ||
Organism | Escherichia coli strain SCU-115 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | F4T5C6 |
Locus tag | HPE48_RS15955 | Protein ID | WP_001135731.1 |
Coordinates | 3290325..3290477 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 3290221..3290275 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HPE48_RS15935 | 3285449..3286444 | - | 996 | WP_001182627.1 | O-acetyltransferase WecH | - |
HPE48_RS15940 | 3286619..3286918 | + | 300 | WP_000980102.1 | YsaB family lipoprotein | - |
HPE48_RS15945 | 3287013..3287924 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
HPE48_RS15950 | 3287934..3290003 | + | 2070 | WP_001291788.1 | glycine--tRNA ligase subunit beta | - |
- | 3290221..3290275 | - | 55 | - | - | Antitoxin |
HPE48_RS15955 | 3290325..3290477 | + | 153 | WP_001135731.1 | type I toxin-antitoxin system toxin HokA | Toxin |
HPE48_RS15960 | 3290665..3290877 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
HPE48_RS15965 | 3291158..3291448 | - | 291 | WP_000455798.1 | HTH-type transcriptional regulator | - |
HPE48_RS15970 | 3291882..3292592 | + | 711 | WP_000190516.1 | DUF3053 domain-containing protein | - |
HPE48_RS15975 | 3292642..3293616 | - | 975 | WP_174144025.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
HPE48_RS15980 | 3293720..3294379 | - | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 6025.30 Da Isoelectric Point: 7.7169
>T159520 WP_001135731.1 NZ_CP054368:3290325-3290477 [Escherichia coli]
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
MPQKYRLLSLIVICFTLLFFTWMIRDSLCELHIKQENYELAAFLACKLKE
Download Length: 153 bp
>T159520 NZ_CP070070:c31769-31617 [Escherichia coli]
ATGCCACAGCGAACATTTTTAATGATGTTGATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGGCTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACATTTTTAATGATGTTGATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGGCTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 55 bp
>AT159520 NZ_CP054368:c3290275-3290221 [Escherichia coli]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|