Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 47827..48066 | Replicon | plasmid p1 |
| Accession | NZ_CP054220 | ||
| Organism | Escherichia coli strain EcPF18 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | HR075_RS24500 | Protein ID | WP_023144756.1 |
| Coordinates | 47827..47961 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 48006..48066 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HR075_RS24470 | 43838..44239 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| HR075_RS24475 | 44172..44429 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| HR075_RS24480 | 44522..45175 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| HR075_RS24485 | 46115..46972 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| HR075_RS24490 | 46965..47039 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| HR075_RS24495 | 47276..47530 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| HR075_RS24500 | 47827..47961 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 48006..48066 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 48006..48066 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 48006..48066 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 48006..48066 | + | 61 | NuclAT_2 | - | Antitoxin |
| HR075_RS24505 | 48033..48319 | - | 287 | Protein_54 | DUF2726 domain-containing protein | - |
| HR075_RS24510 | 48397..50010 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| HR075_RS24515 | 50041..50391 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| HR075_RS24520 | 50388..50813 | - | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
| HR075_RS24525 | 51372..51584 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| HR075_RS24530 | 51715..52275 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B | senB | 1..128954 | 128954 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T159020 WP_023144756.1 NZ_CP054220:c47961-47827 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T159020 NZ_CP069940:c456347-456245 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 61 bp
>AT159020 NZ_CP054220:48006-48066 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|