Detailed information of TA system TA159016

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 4937317..4937538
• Replicon: chromosome
• Accession: NZ_CP054219
• Organism: Escherichia coli strain EcPF18

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A1U9U3P9
• Locus tag: HR075_RS23815
• Protein ID: WP_001531632.1
• Coordinates: 4937317..4937424 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	4937472..4937538 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HR075_RS23790	4933161..4934243	+	1083	WP_000804726.1	peptide chain release factor 1	-
HR075_RS23795	4934243..4935076	+	834	WP_000456450.1	peptide chain release factor N(5)-glutamine methyltransferase	-
HR075_RS23800	4935073..4935465	+	393	WP_000200375.1	invasion regulator SirB2	-
HR075_RS23805	4935469..4936278	+	810	WP_001257044.1	invasion regulator SirB1	-
HR075_RS23810	4936314..4937168	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
HR075_RS23815	4937317..4937424	-	108	WP_001531632.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4937472..4937538	+	67	NuclAT_10	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_10	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_10	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_10	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_5	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_5	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_5	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_5	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_6	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_6	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_6	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_6	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_7	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_7	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_7	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_7	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_8	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_8	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_8	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_8	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_9	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_9	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_9	-	Antitoxin
-	4937472..4937538	+	67	NuclAT_9	-	Antitoxin
-	4937474..4937537	+	64	NuclAT_12	-	-
-	4937474..4937537	+	64	NuclAT_12	-	-
-	4937474..4937537	+	64	NuclAT_12	-	-
-	4937474..4937537	+	64	NuclAT_12	-	-
-	4937474..4937537	+	64	NuclAT_13	-	-
-	4937474..4937537	+	64	NuclAT_13	-	-
-	4937474..4937537	+	64	NuclAT_13	-	-
-	4937474..4937537	+	64	NuclAT_13	-	-
-	4937474..4937537	+	64	NuclAT_14	-	-
-	4937474..4937537	+	64	NuclAT_14	-	-
-	4937474..4937537	+	64	NuclAT_14	-	-
-	4937474..4937537	+	64	NuclAT_14	-	-
-	4937474..4937537	+	64	NuclAT_15	-	-
-	4937474..4937537	+	64	NuclAT_15	-	-
-	4937474..4937537	+	64	NuclAT_15	-	-
-	4937474..4937537	+	64	NuclAT_15	-	-
-	4937474..4937537	+	64	NuclAT_16	-	-
-	4937474..4937537	+	64	NuclAT_16	-	-
-	4937474..4937537	+	64	NuclAT_16	-	-
-	4937474..4937537	+	64	NuclAT_16	-	-
-	4937474..4937537	+	64	NuclAT_17	-	-
-	4937474..4937537	+	64	NuclAT_17	-	-
-	4937474..4937537	+	64	NuclAT_17	-	-
-	4937474..4937537	+	64	NuclAT_17	-	-
-	4937474..4937539	+	66	NuclAT_18	-	-
-	4937474..4937539	+	66	NuclAT_18	-	-
-	4937474..4937539	+	66	NuclAT_18	-	-
-	4937474..4937539	+	66	NuclAT_18	-	-
-	4937474..4937539	+	66	NuclAT_19	-	-
-	4937474..4937539	+	66	NuclAT_19	-	-
-	4937474..4937539	+	66	NuclAT_19	-	-
-	4937474..4937539	+	66	NuclAT_19	-	-
-	4937474..4937539	+	66	NuclAT_20	-	-
-	4937474..4937539	+	66	NuclAT_20	-	-
-	4937474..4937539	+	66	NuclAT_20	-	-
-	4937474..4937539	+	66	NuclAT_20	-	-
-	4937474..4937539	+	66	NuclAT_21	-	-
-	4937474..4937539	+	66	NuclAT_21	-	-
-	4937474..4937539	+	66	NuclAT_21	-	-
-	4937474..4937539	+	66	NuclAT_21	-	-
-	4937474..4937539	+	66	NuclAT_22	-	-
-	4937474..4937539	+	66	NuclAT_22	-	-
-	4937474..4937539	+	66	NuclAT_22	-	-
-	4937474..4937539	+	66	NuclAT_22	-	-
-	4937474..4937539	+	66	NuclAT_23	-	-
-	4937474..4937539	+	66	NuclAT_23	-	-
-	4937474..4937539	+	66	NuclAT_23	-	-
-	4937474..4937539	+	66	NuclAT_23	-	-
HR075_RS23820	4937829..4938929	-	1101	WP_000063608.1	sodium-potassium/proton antiporter ChaA	-
HR075_RS23825	4939199..4939438	+	240	WP_000120702.1	putative cation transport regulator ChaB	-
HR075_RS23830	4939587..4940282	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
HR075_RS23835	4940326..4940679	-	354	WP_001169659.1	DsrE/F sulfur relay family protein YchN	-
HR075_RS23840	4940864..4942258	+	1395	WP_000086187.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4040.89 Da
• Isoelectric Point: 12.5163

>T159016 WP_001531632.1 NZ_CP054219:c4937424-4937317 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Nucleotide

• Length: 108 bp

>T159016 NZ_CP069939:3214443-3214790 [Klebsiella pneumoniae]
ATGTGGGATGTAGAAACGACGGATACGTTTGATACCTGGTTCGAATTACAAAGTAGAGCTTTAAAAGAGGATATGTTGGC
CACGATGCTCATCCTGTCTGAGTTTGCTCCGCAGCTTGGGCGCCCGTATGTTGATACGGTGAAAGATTCAACGTTTCAGA
ATATGAAAGAACTGCGGGTTCAGCATCATGGGCTCCCCATCCGCGCCTTTTTTGCTTTTGATCCTCTGCGGAAAGCTATC
GTTTTATGTGCGGGCAATAAGGATGGCATGAATGAGAAACGTTTTTACAAAGAGATGATTACTCTGGCTGACAGAGAATT
CAGCCAACACCTGACTAAGGAGCGATAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT159016 NZ_CP054219:4937472-4937538 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A1U9U3P9

Antitoxin