Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1664592..1664812 Replicon chromosome
Accession NZ_CP054169
Organism Escherichia coli strain STO_Bone1B

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag HRS04_RS08945 Protein ID WP_000170965.1
Coordinates 1664592..1664699 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1664746..1664812 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HRS04_RS08915 1660447..1661280 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
HRS04_RS08920 1661277..1661669 + 393 WP_000200392.1 invasion regulator SirB2 -
HRS04_RS08925 1661673..1662482 + 810 WP_001257044.1 invasion regulator SirB1 -
HRS04_RS08930 1662518..1663372 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HRS04_RS08935 1663521..1663628 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1663676..1663742 + 67 NuclAT_44 - -
- 1663676..1663742 + 67 NuclAT_44 - -
- 1663676..1663742 + 67 NuclAT_44 - -
- 1663676..1663742 + 67 NuclAT_44 - -
- 1663676..1663742 + 67 NuclAT_47 - -
- 1663676..1663742 + 67 NuclAT_47 - -
- 1663676..1663742 + 67 NuclAT_47 - -
- 1663676..1663742 + 67 NuclAT_47 - -
- 1663676..1663742 + 67 NuclAT_50 - -
- 1663676..1663742 + 67 NuclAT_50 - -
- 1663676..1663742 + 67 NuclAT_50 - -
- 1663676..1663742 + 67 NuclAT_50 - -
- 1663678..1663741 + 64 NuclAT_16 - -
- 1663678..1663741 + 64 NuclAT_16 - -
- 1663678..1663741 + 64 NuclAT_16 - -
- 1663678..1663741 + 64 NuclAT_16 - -
- 1663678..1663741 + 64 NuclAT_19 - -
- 1663678..1663741 + 64 NuclAT_19 - -
- 1663678..1663741 + 64 NuclAT_19 - -
- 1663678..1663741 + 64 NuclAT_19 - -
- 1663678..1663741 + 64 NuclAT_22 - -
- 1663678..1663741 + 64 NuclAT_22 - -
- 1663678..1663741 + 64 NuclAT_22 - -
- 1663678..1663741 + 64 NuclAT_22 - -
- 1663678..1663741 + 64 NuclAT_25 - -
- 1663678..1663741 + 64 NuclAT_25 - -
- 1663678..1663741 + 64 NuclAT_25 - -
- 1663678..1663741 + 64 NuclAT_25 - -
- 1663678..1663741 + 64 NuclAT_28 - -
- 1663678..1663741 + 64 NuclAT_28 - -
- 1663678..1663741 + 64 NuclAT_28 - -
- 1663678..1663741 + 64 NuclAT_28 - -
- 1663678..1663741 + 64 NuclAT_31 - -
- 1663678..1663741 + 64 NuclAT_31 - -
- 1663678..1663741 + 64 NuclAT_31 - -
- 1663678..1663741 + 64 NuclAT_31 - -
HRS04_RS08940 1664056..1664163 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1664216..1664277 + 62 NuclAT_15 - -
- 1664216..1664277 + 62 NuclAT_15 - -
- 1664216..1664277 + 62 NuclAT_15 - -
- 1664216..1664277 + 62 NuclAT_15 - -
- 1664216..1664277 + 62 NuclAT_18 - -
- 1664216..1664277 + 62 NuclAT_18 - -
- 1664216..1664277 + 62 NuclAT_18 - -
- 1664216..1664277 + 62 NuclAT_18 - -
- 1664216..1664277 + 62 NuclAT_21 - -
- 1664216..1664277 + 62 NuclAT_21 - -
- 1664216..1664277 + 62 NuclAT_21 - -
- 1664216..1664277 + 62 NuclAT_21 - -
- 1664216..1664277 + 62 NuclAT_24 - -
- 1664216..1664277 + 62 NuclAT_24 - -
- 1664216..1664277 + 62 NuclAT_24 - -
- 1664216..1664277 + 62 NuclAT_24 - -
- 1664216..1664277 + 62 NuclAT_27 - -
- 1664216..1664277 + 62 NuclAT_27 - -
- 1664216..1664277 + 62 NuclAT_27 - -
- 1664216..1664277 + 62 NuclAT_27 - -
- 1664216..1664277 + 62 NuclAT_30 - -
- 1664216..1664277 + 62 NuclAT_30 - -
- 1664216..1664277 + 62 NuclAT_30 - -
- 1664216..1664277 + 62 NuclAT_30 - -
- 1664216..1664278 + 63 NuclAT_45 - -
- 1664216..1664278 + 63 NuclAT_45 - -
- 1664216..1664278 + 63 NuclAT_45 - -
- 1664216..1664278 + 63 NuclAT_45 - -
- 1664216..1664278 + 63 NuclAT_48 - -
- 1664216..1664278 + 63 NuclAT_48 - -
- 1664216..1664278 + 63 NuclAT_48 - -
- 1664216..1664278 + 63 NuclAT_48 - -
- 1664216..1664278 + 63 NuclAT_51 - -
- 1664216..1664278 + 63 NuclAT_51 - -
- 1664216..1664278 + 63 NuclAT_51 - -
- 1664216..1664278 + 63 NuclAT_51 - -
- 1664216..1664279 + 64 NuclAT_33 - -
- 1664216..1664279 + 64 NuclAT_33 - -
- 1664216..1664279 + 64 NuclAT_33 - -
- 1664216..1664279 + 64 NuclAT_33 - -
- 1664216..1664279 + 64 NuclAT_35 - -
- 1664216..1664279 + 64 NuclAT_35 - -
- 1664216..1664279 + 64 NuclAT_35 - -
- 1664216..1664279 + 64 NuclAT_35 - -
- 1664216..1664279 + 64 NuclAT_37 - -
- 1664216..1664279 + 64 NuclAT_37 - -
- 1664216..1664279 + 64 NuclAT_37 - -
- 1664216..1664279 + 64 NuclAT_37 - -
- 1664216..1664279 + 64 NuclAT_39 - -
- 1664216..1664279 + 64 NuclAT_39 - -
- 1664216..1664279 + 64 NuclAT_39 - -
- 1664216..1664279 + 64 NuclAT_39 - -
- 1664216..1664279 + 64 NuclAT_41 - -
- 1664216..1664279 + 64 NuclAT_41 - -
- 1664216..1664279 + 64 NuclAT_41 - -
- 1664216..1664279 + 64 NuclAT_41 - -
- 1664216..1664279 + 64 NuclAT_43 - -
- 1664216..1664279 + 64 NuclAT_43 - -
- 1664216..1664279 + 64 NuclAT_43 - -
- 1664216..1664279 + 64 NuclAT_43 - -
HRS04_RS08945 1664592..1664699 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1664746..1664812 + 67 - - Antitoxin
HRS04_RS08950 1665104..1666204 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
HRS04_RS08955 1666474..1666704 + 231 WP_001146442.1 putative cation transport regulator ChaB -
HRS04_RS08960 1666862..1667557 + 696 WP_094658721.1 glutathione-specific gamma-glutamylcyclotransferase -
HRS04_RS08965 1667601..1667954 - 354 WP_001169671.1 DsrE/F sulfur relay family protein YchN -
HRS04_RS08970 1668139..1669533 + 1395 WP_000086213.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T158863 WP_000170965.1 NZ_CP054169:c1664699-1664592 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T158863 NZ_CP069865:3253478-3253876 [Escherichia coli]
ATGCGGGTATTCAAAACAAAACTTATTCGCCTGCAACTTACAGCAGAGGAACTTGATGCGTTAACGGCGGATTTTATTTC
CTATAAGCGTGACGGTATTTTGCCAGATATATTTGGTCGCGATGCACTCTACGACGACTCGTTTACCTGGCCATTAATCA
AATTTGAGCGAGTTGCTCATATTCATCTGGCAAATGTGAATAATCCATTTCCGCCACAGTTGCGCCAATTCAGCAGAACG
AATGACGAAGCGCATTTGGTATATTGTCAGGGGGCGTTTGATGAGCAAGCATGGTTGCTCATTGCCATTCTGAAGCCTGA
ACCTCATAAACTGGCTCGAGATAACAACCAAATGCATAAAATTGGAAAAATGGCAGAAGCGTTTCGCATGCGTTTTTGA

Antitoxin


Download         Length: 67 bp

>AT158863 NZ_CP054169:1664746-1664812 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References