Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1664056..1664277 | Replicon | chromosome |
| Accession | NZ_CP054169 | ||
| Organism | Escherichia coli strain STO_Bone1B | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E0IV43 |
| Locus tag | HRS04_RS08940 | Protein ID | WP_000170926.1 |
| Coordinates | 1664056..1664163 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1664216..1664277 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HRS04_RS08910 (1659365) | 1659365..1660447 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| HRS04_RS08915 (1660447) | 1660447..1661280 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| HRS04_RS08920 (1661277) | 1661277..1661669 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| HRS04_RS08925 (1661673) | 1661673..1662482 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| HRS04_RS08930 (1662518) | 1662518..1663372 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| HRS04_RS08935 (1663521) | 1663521..1663628 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_16 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_16 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_16 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_16 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_19 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_19 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_19 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_19 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_22 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_22 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_22 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_22 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_25 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_25 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_25 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_25 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_28 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_28 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_28 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_28 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_31 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_31 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_31 | - | - |
| - (1663678) | 1663678..1663741 | + | 64 | NuclAT_31 | - | - |
| - (1663676) | 1663676..1663742 | + | 67 | NuclAT_44 | - | - |
| - (1663676) | 1663676..1663742 | + | 67 | NuclAT_44 | - | - |
| - (1663676) | 1663676..1663742 | + | 67 | NuclAT_44 | - | - |
| - (1663676) | 1663676..1663742 | + | 67 | NuclAT_44 | - | - |
| - (1663676) | 1663676..1663742 | + | 67 | NuclAT_47 | - | - |
| - (1663676) | 1663676..1663742 | + | 67 | NuclAT_47 | - | - |
| - (1663676) | 1663676..1663742 | + | 67 | NuclAT_47 | - | - |
| - (1663676) | 1663676..1663742 | + | 67 | NuclAT_47 | - | - |
| - (1663676) | 1663676..1663742 | + | 67 | NuclAT_50 | - | - |
| - (1663676) | 1663676..1663742 | + | 67 | NuclAT_50 | - | - |
| - (1663676) | 1663676..1663742 | + | 67 | NuclAT_50 | - | - |
| - (1663676) | 1663676..1663742 | + | 67 | NuclAT_50 | - | - |
| HRS04_RS08940 (1664056) | 1664056..1664163 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_15 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_15 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_15 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_15 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_21 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_24 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_27 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (1664216) | 1664216..1664277 | + | 62 | NuclAT_30 | - | Antitoxin |
| - (1664216) | 1664216..1664278 | + | 63 | NuclAT_45 | - | - |
| - (1664216) | 1664216..1664278 | + | 63 | NuclAT_45 | - | - |
| - (1664216) | 1664216..1664278 | + | 63 | NuclAT_45 | - | - |
| - (1664216) | 1664216..1664278 | + | 63 | NuclAT_45 | - | - |
| - (1664216) | 1664216..1664278 | + | 63 | NuclAT_48 | - | - |
| - (1664216) | 1664216..1664278 | + | 63 | NuclAT_48 | - | - |
| - (1664216) | 1664216..1664278 | + | 63 | NuclAT_48 | - | - |
| - (1664216) | 1664216..1664278 | + | 63 | NuclAT_48 | - | - |
| - (1664216) | 1664216..1664278 | + | 63 | NuclAT_51 | - | - |
| - (1664216) | 1664216..1664278 | + | 63 | NuclAT_51 | - | - |
| - (1664216) | 1664216..1664278 | + | 63 | NuclAT_51 | - | - |
| - (1664216) | 1664216..1664278 | + | 63 | NuclAT_51 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_33 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_33 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_33 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_33 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_35 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_35 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_35 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_35 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_37 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_37 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_37 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_37 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_39 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_39 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_39 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_39 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_41 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_41 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_41 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_41 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_43 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_43 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_43 | - | - |
| - (1664216) | 1664216..1664279 | + | 64 | NuclAT_43 | - | - |
| HRS04_RS08945 (1664592) | 1664592..1664699 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_14 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_14 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_14 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_14 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_17 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_17 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_17 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_17 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_20 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_20 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_20 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_20 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_23 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_23 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_23 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_23 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_26 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_26 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_26 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_26 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_29 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_29 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_29 | - | - |
| - (1664747) | 1664747..1664812 | + | 66 | NuclAT_29 | - | - |
| - (1664748) | 1664748..1664813 | + | 66 | NuclAT_46 | - | - |
| - (1664748) | 1664748..1664813 | + | 66 | NuclAT_46 | - | - |
| - (1664748) | 1664748..1664813 | + | 66 | NuclAT_46 | - | - |
| - (1664748) | 1664748..1664813 | + | 66 | NuclAT_46 | - | - |
| - (1664748) | 1664748..1664813 | + | 66 | NuclAT_49 | - | - |
| - (1664748) | 1664748..1664813 | + | 66 | NuclAT_49 | - | - |
| - (1664748) | 1664748..1664813 | + | 66 | NuclAT_49 | - | - |
| - (1664748) | 1664748..1664813 | + | 66 | NuclAT_49 | - | - |
| - (1664748) | 1664748..1664813 | + | 66 | NuclAT_52 | - | - |
| - (1664748) | 1664748..1664813 | + | 66 | NuclAT_52 | - | - |
| - (1664748) | 1664748..1664813 | + | 66 | NuclAT_52 | - | - |
| - (1664748) | 1664748..1664813 | + | 66 | NuclAT_52 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_32 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_32 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_32 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_32 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_34 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_34 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_34 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_34 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_36 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_36 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_36 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_36 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_38 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_38 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_38 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_38 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_40 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_40 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_40 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_40 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_42 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_42 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_42 | - | - |
| - (1664747) | 1664747..1664814 | + | 68 | NuclAT_42 | - | - |
| HRS04_RS08950 (1665104) | 1665104..1666204 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| HRS04_RS08955 (1666474) | 1666474..1666704 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| HRS04_RS08960 (1666862) | 1666862..1667557 | + | 696 | WP_094658721.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| HRS04_RS08965 (1667601) | 1667601..1667954 | - | 354 | WP_001169671.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.84 Da Isoelectric Point: 11.6501
>T158859 WP_000170926.1 NZ_CP054169:c1664163-1664056 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T158859 NZ_CP069865:2644641-2644814 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 62 bp
>AT158859 NZ_CP054169:1664216-1664277 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|