Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 938068..938229 | Replicon | chromosome |
Accession | NZ_CP054017 | ||
Organism | Staphylococcus warneri strain FDAARGOS_754 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | FOC62_RS04615 | Protein ID | WP_015364873.1 |
Coordinates | 938134..938229 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 938068..938102 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FOC62_RS04590 | 934064..934804 | - | 741 | WP_002452116.1 | ABC transporter ATP-binding protein | - |
FOC62_RS04595 | 934936..935361 | + | 426 | WP_002452115.1 | HIT family protein | - |
FOC62_RS04600 | 935439..935810 | + | 372 | WP_002452114.1 | YtxH domain-containing protein | - |
FOC62_RS04605 | 936004..936561 | + | 558 | WP_002452113.1 | DUF3267 domain-containing protein | - |
FOC62_RS04610 | 936990..937982 | + | 993 | WP_002452112.1 | peptidylprolyl isomerase | - |
- | 938068..938102 | + | 35 | - | - | Antitoxin |
FOC62_RS04615 | 938134..938229 | - | 96 | WP_015364873.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
FOC62_RS04620 | 938381..939322 | - | 942 | WP_002452110.1 | 3'-5' exoribonuclease YhaM | - |
FOC62_RS04625 | 939322..942255 | - | 2934 | WP_002452109.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3610.26 Da Isoelectric Point: 8.0878
>T158517 WP_015364873.1 NZ_CP054017:c938229-938134 [Staphylococcus warneri]
MTEIFVHIATTVISGCIVTLFAHWLRHRNDK
MTEIFVHIATTVISGCIVTLFAHWLRHRNDK
Download Length: 96 bp
>T158517 NZ_CP069657:2799197-2799304 [Escherichia coli O89m:H10]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 35 bp
>AT158517 NZ_CP054017:938068-938102 [Staphylococcus warneri]
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|