Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 70658..70911 | Replicon | plasmid pMHMC-004 |
| Accession | NZ_CP053755 | ||
| Organism | Shigella sonnei strain 506 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | COO90_RS27150 | Protein ID | WP_001312851.1 |
| Coordinates | 70658..70807 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 70852..70911 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| COO90_RS27120 (66680) | 66680..67081 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| COO90_RS27125 (67014) | 67014..67271 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| COO90_RS27130 (67364) | 67364..68017 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| COO90_RS27135 (68956) | 68956..69813 | - | 858 | WP_016240488.1 | incFII family plasmid replication initiator RepA | - |
| COO90_RS27140 (69806) | 69806..69880 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| COO90_RS27145 (70125) | 70125..70373 | - | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| COO90_RS27150 (70658) | 70658..70807 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (70852) | 70852..70911 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (70852) | 70852..70911 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (70852) | 70852..70911 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (70852) | 70852..70911 | + | 60 | NuclAT_1 | - | Antitoxin |
| COO90_RS27155 (71054) | 71054..71527 | - | 474 | WP_016240489.1 | hypothetical protein | - |
| COO90_RS27160 (71682) | 71682..72272 | - | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
| COO90_RS27165 (72310) | 72310..72519 | - | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| COO90_RS27170 (72565) | 72565..73026 | - | 462 | WP_001233850.1 | thermonuclease family protein | - |
| COO90_RS27175 (73272) | 73272..73484 | - | 213 | WP_001301409.1 | ANR family transcriptional regulator | - |
| COO90_RS27180 (73616) | 73616..74176 | - | 561 | WP_033807966.1 | fertility inhibition protein FinO | - |
| COO90_RS27185 (74231) | 74231..74977 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(B) / mph(A) / sul1 / qacE / aadA5 / blaTEM-1B | - | 1..80217 | 80217 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T157738 WP_001312851.1 NZ_CP053755:c70807-70658 [Shigella sonnei]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T157738 NZ_CP069453:2047491-2047664 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTCTTCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTTCTGGTCGGAATAACCTGGCCAATGAGTCTTCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 60 bp
>AT157738 NZ_CP053755:70852-70911 [Shigella sonnei]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
